Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55422
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 331
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF331
Synonyms (NCBI Gene) Gene synonyms aliases
RITA, ZNF361, ZNF463
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050511 hsa-miR-20a-5p CLASH 23622248
MIRT542433 hsa-miR-508-5p PAR-CLIP 21572407
MIRT542432 hsa-miR-5586-3p PAR-CLIP 21572407
MIRT542431 hsa-miR-6849-3p PAR-CLIP 21572407
MIRT542430 hsa-miR-939-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of transcription, DNA-templated IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606043 15489 ENSG00000130844
Protein
UniProt ID Q9NQX6
Protein name Zinc finger protein 331 (C2H2-like zinc finger protein rearranged in thyroid adenomas) (Zinc finger protein 361) (Zinc finger protein 463)
Protein function May be involved in transcriptional regulation. May play a role in spermatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 5 46 KRAB box Family
PF00096 zf-C2H2 131 153 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 159 184 Domain
PF00096 zf-C2H2 187 209 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 215 237 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 243 265 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 299 321 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 327 352 Domain
PF00096 zf-C2H2 383 405 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 411 433 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 439 461 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence
MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEK
NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPR
THQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKI
HTGE
KPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGE
KDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYE
CQECGKAFTRVNYLTQHQKIH
TGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTEC
GKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSF
SHGHQLTQHQKTH
SGAKSYECKECGKACNHLNHLREHQRIHNS
Sequence length 463
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Stress Disorder Stress Disorder GWAS
Associations from Text Mining
Disease Name Relationship Type References
Airway Remodeling Associate 37165378
Breast Neoplasms Associate 23107584
Colorectal Neoplasms Associate 24948044, 29854011
Fetal Growth Retardation Associate 19483473
Gastrointestinal Neoplasms Associate 24948044
Inflammation Associate 31835635
Ketosis Associate 34139469
Neoplasms Associate 19249676, 23107584, 26474454, 33087347
Neoplasms Inhibit 31699971
Neurofibrosarcoma Associate 33831431