Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55328
Gene name	Renalase, FAD dependent amine oxidase
Gene symbol	RNLS
Synonyms (NCBI Gene)	C10orf59RENALASE
Chromosome	10
Chromosome location	10q23.31
Summary	Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT458083	hsa-miR-548n	PAR-CLIP	23592263
MIRT458082	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT458081	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT458080	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT458079	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT458078	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT458077	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT458076	hsa-miR-9500	PAR-CLIP	23592263
MIRT458075	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT458074	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT458073	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT458071	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT458083	hsa-miR-548n	PAR-CLIP	23592263
MIRT458082	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT458081	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT458080	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT458079	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT458078	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT458077	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT458076	hsa-miR-9500	PAR-CLIP	23592263
MIRT458075	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT458074	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT458073	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT458071	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT1314025	hsa-miR-1273d	CLIP-seq
MIRT1314026	hsa-miR-142-5p	CLIP-seq
MIRT1314027	hsa-miR-194	CLIP-seq
MIRT1314028	hsa-miR-3120-3p	CLIP-seq
MIRT1314029	hsa-miR-4434	CLIP-seq
MIRT1314030	hsa-miR-4516	CLIP-seq
MIRT1314031	hsa-miR-4531	CLIP-seq
MIRT1314032	hsa-miR-548a-5p	CLIP-seq
MIRT1314033	hsa-miR-548ab	CLIP-seq
MIRT1314034	hsa-miR-548ak	CLIP-seq
MIRT1314035	hsa-miR-548b-5p	CLIP-seq
MIRT1314036	hsa-miR-548c-5p	CLIP-seq
MIRT1314037	hsa-miR-548d-5p	CLIP-seq
MIRT1314038	hsa-miR-548h	CLIP-seq
MIRT1314039	hsa-miR-548i	CLIP-seq
MIRT1314040	hsa-miR-548j	CLIP-seq
MIRT1314041	hsa-miR-548k	CLIP-seq
MIRT1314042	hsa-miR-548l	CLIP-seq
MIRT1314043	hsa-miR-548w	CLIP-seq
MIRT1314044	hsa-miR-548y	CLIP-seq
MIRT1314045	hsa-miR-559	CLIP-seq
MIRT1314046	hsa-miR-589	CLIP-seq
MIRT1314047	hsa-miR-802	CLIP-seq
MIRT1314048	hsa-miR-103a	CLIP-seq
MIRT1314049	hsa-miR-107	CLIP-seq
MIRT1314050	hsa-miR-1224-3p	CLIP-seq
MIRT1314051	hsa-miR-1260	CLIP-seq
MIRT1314052	hsa-miR-1260b	CLIP-seq
MIRT1314053	hsa-miR-1279	CLIP-seq
MIRT1314054	hsa-miR-1280	CLIP-seq
MIRT1314055	hsa-miR-1301	CLIP-seq
MIRT1314056	hsa-miR-181a	CLIP-seq
MIRT1314057	hsa-miR-181b	CLIP-seq
MIRT1314058	hsa-miR-181c	CLIP-seq
MIRT1314059	hsa-miR-181d	CLIP-seq
MIRT1314060	hsa-miR-1827	CLIP-seq
MIRT1314061	hsa-miR-188-3p	CLIP-seq
MIRT1314062	hsa-miR-204	CLIP-seq
MIRT1314063	hsa-miR-211	CLIP-seq
MIRT1314064	hsa-miR-221	CLIP-seq
MIRT1314065	hsa-miR-222	CLIP-seq
MIRT1314066	hsa-miR-25	CLIP-seq
MIRT1314067	hsa-miR-3156-3p	CLIP-seq
MIRT1314068	hsa-miR-32	CLIP-seq
MIRT1314069	hsa-miR-363	CLIP-seq
MIRT1314070	hsa-miR-3667-3p	CLIP-seq
MIRT1314071	hsa-miR-367	CLIP-seq
MIRT1314072	hsa-miR-4262	CLIP-seq
MIRT1314073	hsa-miR-4477b	CLIP-seq
MIRT1314074	hsa-miR-4755-5p	CLIP-seq
MIRT1314075	hsa-miR-4789-3p	CLIP-seq
MIRT1314076	hsa-miR-499-3p	CLIP-seq
MIRT1314077	hsa-miR-499a-3p	CLIP-seq
MIRT1314078	hsa-miR-5047	CLIP-seq
MIRT1314079	hsa-miR-623	CLIP-seq
MIRT1314080	hsa-miR-92a	CLIP-seq
MIRT1314081	hsa-miR-92b	CLIP-seq
MIRT2093409	hsa-miR-103b	CLIP-seq
MIRT2093410	hsa-miR-1238	CLIP-seq
MIRT2093411	hsa-miR-4691-5p	CLIP-seq
MIRT2093412	hsa-miR-4775	CLIP-seq
MIRT2093413	hsa-miR-3180-5p	CLIP-seq
MIRT2093414	hsa-miR-665	CLIP-seq
MIRT2093415	hsa-miR-892a	CLIP-seq
MIRT2093416	hsa-miR-943	CLIP-seq
MIRT2093413	hsa-miR-3180-5p	CLIP-seq
MIRT2093414	hsa-miR-665	CLIP-seq
MIRT2093415	hsa-miR-892a	CLIP-seq
MIRT2093416	hsa-miR-943	CLIP-seq
MIRT2458491	hsa-miR-129-5p	CLIP-seq
MIRT2458492	hsa-miR-3152-3p	CLIP-seq
MIRT2458493	hsa-miR-513a-3p	CLIP-seq
MIRT2613708	hsa-miR-140-3p	CLIP-seq
MIRT2613709	hsa-miR-3120-5p	CLIP-seq
MIRT2613710	hsa-miR-3144-3p	CLIP-seq
MIRT2613711	hsa-miR-4652-3p	CLIP-seq
MIRT2613709	hsa-miR-3120-5p	CLIP-seq
MIRT2613711	hsa-miR-4652-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	IEA
GO:0005515	Function	Protein binding	IPI	25906147
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	15841207
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0010459	Process	Negative regulation of heart rate	IDA	15841207
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IBA
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IDA	23964689, 25531177
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IEA
GO:0045776	Process	Negative regulation of blood pressure	IDA	15841207
GO:0051379	Function	Epinephrine binding	IDA	23964689
GO:0070404	Function	NADH binding	IDA	25531177
GO:0071869	Process	Response to catecholamine	IEA
GO:0071871	Process	Response to epinephrine	IEA
GO:0097621	Function	Monoamine oxidase activity	IMP	15841207
GO:1902074	Process	Response to salt	IEA

MIM	HGNC	e!Ensembl
609360	25641	ENSG00000184719

Q5VYX0

Protein name

Renalase (EC 1.6.3.5) (Monoamine oxidase-C) (MAO-C)

Protein function

Catalyzes the oxidation of the less abundant 1,2-dihydro-beta-NAD(P) and 1,6-dihydro-beta-NAD(P) to form beta-NAD(P)(+). The enzyme hormone is secreted by the kidney, and circulates in blood and modulates cardiac function and systemic blood pres

PDB

3QJ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13450	NAD_binding_8	6 → 80		Domain
PF01593	Amino_oxidase	84 → 332	Flavin containing amine oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as co

Sequence

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

Sequence length

342

Interactions

View interactions

	Reactome
			Nicotinamide salvaging

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs114231964	RCV005918460
Cholangiocarcinoma	Benign	rs114231964	RCV005918462
Family history	association	rs10887800	RCV002052287
Gastric cancer	Benign	rs114231964	RCV005918461
Stage 5 chronic kidney disease	Benign	rs2296545	RCV001789711

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	25906147
Alcoholism	Associate	30181378
Aortic Valve Stenosis	Associate	29065134
Carcinoma Pancreatic Ductal	Associate	34587190
Cardiomegaly	Associate	20975995, 29065134, 34156537
Cardiomyopathy Hypertrophic	Associate	29065134
Cardiovascular Diseases	Associate	27023477, 28372594
Cerebral Infarction	Associate	30181378, 34603559
Coronary Artery Disease	Associate	20975995, 27023477, 30181378
Coronary Disease	Associate	24821235
Diabetes Mellitus	Associate	21964580, 25906147, 29172403
Diabetes Mellitus Type 1	Associate	21270831, 22403184, 22891215, 26053495
Diabetes Mellitus Type 2	Associate	21964580, 26053495, 34156537
Diabetic Retinopathy	Associate	34156537
Duane Retraction Syndrome	Associate	34156537
Essential Hypertension	Associate	25906147, 30181378
Heart Diseases	Associate	20975995, 25906147
Huntington Disease	Associate	28372594
Hypertension	Associate	21964580, 22812913, 24821235, 25171187, 25531090, 25906147, 34156537, 36789764
Hypertension Pregnancy Induced	Associate	32338092
Hypertensive Retinopathy	Associate	34156537
Hypertrophy Left Ventricular	Associate	20975995, 29065134
Hypoxia	Associate	29065134
Iron Overload	Associate	29065134
Ischemia	Associate	20975995
Kidney Failure Chronic	Associate	27023477, 27577995, 30181378
Lupus Nephritis	Stimulate	26431044
Myocardial Ischemia	Associate	25906147
Pancreatitis	Associate	22403184
Pre Eclampsia	Associate	32338092
Renal Insufficiency Chronic	Associate	25171187, 29172403
Sick Sinus Syndrome	Stimulate	34587190
Stroke	Associate	21964580, 25906147, 34156537
Ventricular Dysfunction	Associate	20975995
Ventricular Dysfunction Left	Associate	20975995

RNLS (renalase, FAD dependent amine oxidase)