Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	553
Gene name Gene Name - the full gene name approved by the HGNC.	Arginine vasopressin receptor 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AVPR1B
Synonyms (NCBI Gene) Gene synonyms aliases	AVPR3, V1bR, VPR3
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosph

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019153	hsa-miR-335-5p	Microarray	18185580
MIRT2179159	hsa-miR-199a-5p	CLIP-seq
MIRT2179160	hsa-miR-199b-5p	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IBA
GO:0005000	Function	Vasopressin receptor activity	IDA	9322919, 15528211
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	TAS	7805841
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	TAS	10858434
GO:0005768	Component	Endosome	TAS	10858434
GO:0005794	Component	Golgi apparatus	IDA	15528211
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15528211, 33713620
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7805841, 10858434
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	15528211
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10858434
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	9322919
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	7929452
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0042127	Process	Regulation of cell population proliferation	IDA	9322919
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9322919
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0046718	Process	Symbiont entry into host cell	IDA	33713620
GO:0060732	Process	Positive regulation of inositol phosphate biosynthetic process	IDA	9322919
GO:0090238	Process	Positive regulation of arachidonate secretion	IDA	9322919
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653

MIM	HGNC	e!Ensembl
600264	896	ENSG00000198049

Protein

UniProt ID

P47901

Protein name

Vasopressin V1b receptor (V1bR) (AVPR V1b) (AVPR V3) (Antidiuretic hormone receptor 1b) (Vasopressin V3 receptor)

Protein function

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, m

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	51 → 338	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Vascular smooth muscle contraction		Vasopressin-like receptors G alpha (q) signalling events Defective AVP does not bind AVPR1A,B and causes neurohypophyseal diabetes insipidus (NDI)

AVPR1B (arginine vasopressin receptor 1B)