AVPR1B (arginine vasopressin receptor 1B)

Gene

• Entrez ID: 553
• Gene name: Arginine vasopressin receptor 1B
• Gene symbol: AVPR1B
• Synonyms (NCBI Gene): AVPR3, V1bR, VPR3
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019153	hsa-miR-335-5p	Microarray	18185580
MIRT2179159	hsa-miR-199a-5p	CLIP-seq
MIRT2179160	hsa-miR-199b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005000	Function	Vasopressin receptor activity	IBA	21873635
GO:0005000	Function	Vasopressin receptor activity	IDA	9322919, 15528211
GO:0005080	Function	Protein kinase C binding	TAS	10858434
GO:0005768	Component	Endosome	TAS	10858434
GO:0005794	Component	Golgi apparatus	IDA	15528211
GO:0005886	Component	Plasma membrane	IDA	15528211
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	15528211
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007202	Process	Activation of phospholipase C activity	IDA	9322919
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	7929452
GO:0032430	Process	Positive regulation of phospholipase A2 activity	IDA	9322919
GO:0042127	Process	Regulation of cell population proliferation	IDA	9322919
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9322919
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0060732	Process	Positive regulation of inositol phosphate biosynthetic process	IDA	9322919
GO:0090238	Process	Positive regulation of arachidonic acid secretion	IDA	9322919
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653

Other IDs

• MIM: 600264
• HGNC: 896
• e!Ensembl: ENSG00000198049

Protein

• UniProt ID: P47901
• Protein name: Vasopressin V1b receptor (V1bR) (AVPR V1b) (AVPR V3) (Antidiuretic hormone receptor 1b) (Vasopressin V3 receptor)
• Protein function: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, m
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 338	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
  QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
  STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
  SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
  GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
  QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
  PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
  TIIF

• Sequence length: 424

Pathways

KEGG:

Calcium signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

Vasopressin-like receptors
G alpha (q) signalling events
Defective AVP does not bind AVPR1A,B and causes neurohypophyseal diabetes insipidus (NDI)