Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55297
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 91
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC91
Synonyms (NCBI Gene) Gene synonyms aliases
HSD8, p56
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p11.22
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT625140 hsa-miR-8485 HITS-CLIP 23824327
MIRT625139 hsa-miR-329-3p HITS-CLIP 23824327
MIRT625138 hsa-miR-362-3p HITS-CLIP 23824327
MIRT629246 hsa-miR-5689 HITS-CLIP 23824327
MIRT625140 hsa-miR-8485 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005794 Component Golgi apparatus IDA
GO:0005794 Component Golgi apparatus IEA
GO:0005802 Component Trans-Golgi network IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617366 24855 ENSG00000123106
Protein
UniProt ID Q7Z6B0
Protein name Coiled-coil domain-containing protein 91 (GGA-binding partner) (p56 accessory protein)
Protein function Involved in the regulation of membrane traffic through the trans-Golgi network (TGN). Functions in close cooperation with the GGAs in the sorting of hydrolases to lysosomes.
PDB 1OM9
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12808037}.
Sequence
MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIG
CLSSDAIISSPENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVD
DSEDPGANVSNIQLQQKISSLEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQE
AISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSVKQQVEAIEKQYISAI
EKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQSQEQKEILEKCLEEERQRNK
EALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEKVSQEIQKAIQ
EQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL
FLSCAQKQLSALIATEPVDIE
Sequence length 441
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Autism Spectrum Disorder autism spectrum disorder N/A N/A GenCC
Breast Cancer Postmenopausal breast cancer, Breast cancer (estrogen-receptor negative, progesterone-receptor negative, and human epidermal growth factor-receptor negative) N/A N/A GWAS
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer, Breast Cancer in BRCA1 mutation carriers N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 27459855
Hyperostosis Diffuse Idiopathic Skeletal Associate 37156767
Lung Diseases Associate 26635082
Neoplasm Recurrence Local Associate 37393630
Ossification of the posterior longitudinal ligament of the spine Associate 36990086