PACC1 (proton activated chloride channel 1)

Gene

• Entrez ID: 55248
• Gene name: Proton activated chloride channel 1
• Gene symbol: PACC1
• Synonyms (NCBI Gene): ASOR, C1orf75, PAC, PAORAC, TMEM206, hPAC, hTMEM206
• Chromosome: 1
• Chromosome location: 1q32.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IDA	31023925, 31318332
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IDA	31023925, 31318332
GO:0006821	Process	Chloride transport	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0061797	Function	PH-gated chloride channel activity	IDA	31023925, 31318332
GO:0061797	Function	PH-gated chloride channel activity	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA

Other IDs

• MIM: 618427
• HGNC: 25593
• e!Ensembl: ENSG00000065600

Protein

• UniProt ID: Q9H813
• Protein name: Proton-activated chloride channel (PAC) (hPAC) (Acid-sensitive outwardly-rectifying anion channel) (ASOR) (Proton-activated outwardly rectifying anion channel) (PAORAC) (Transmembrane protein 206) (hTMEM206)
• Protein function: Chloride channel gated by pH that facilitates the entry of chloride ions into cells upon exposure to extracellular acidic pH (PubMed:31023925, PubMed:31318332). Involved in acidosis-induced cell death by mediating chloride influx and subsequent
• PDB: 7JNA, 7JNC, 7SQF, 7SQG, 7SQH, 8EQ4, 8FBL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15122	TMEM206	55 → 349	TMEM206 protein family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with highest expression in brain. {ECO:0000269|PubMed:31023925}.
• Sequence:

  MIRQERSTSYQELSEELVQVVENSELADEQDKETVRVQGPGILPGLDSESASSSIRFSKA
  CLKNVFSVLLIFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP
  GQAQLLSCKHHYEVIPPLTSPGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKR
  ELVFLQFRLNKSSEDFSAIDYLLFSSFQEFLQSPNRVGFMQACESAYSSWKFSGGFRTWV
  KMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQLFFVVFEWKDPFIQKVQDIVT
  ANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYLKRRGQATSHIS

• Sequence length: 350