NEIL3 (nei like DNA glycosylase 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 55247
Gene name Nei like DNA glycosylase 3
Gene symbol NEIL3
Synonyms (NCBI Gene)
FGP2FPG2NEI3ZGRF3hFPG2hNEI3
Chromosome 4
Chromosome location 4q34.3
Summary NEIL3 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the ass
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT024831 hsa-miR-215-5p Microarray 19074876
MIRT026184 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (44)
GO ID Ontology Definition Evidence Reference
GO:0000012 Process Single strand break repair IDA 19170771
GO:0000405 Function Bubble DNA binding IEA
GO:0000405 Function Bubble DNA binding ISS
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608934 24573 ENSG00000109674
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TAT5
Protein name Endonuclease 8-like 3 (EC 3.2.2.-) (EC 4.2.99.18) (DNA glycosylase FPG2) (DNA glycosylase/AP lyase Neil3) (Endonuclease VIII-like 3) (Nei-like protein 3)
Protein function DNA glycosylase which prefers single-stranded DNA (ssDNA), or partially ssDNA structures such as bubble and fork structures, to double-stranded DNA (dsDNA) (PubMed:12433996, PubMed:19170771, PubMed:22569481, PubMed:23755964). Mediates interstran
PDB 7JL5 , 7TMY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06831 H2TH 153 → 231 Formamidopyrimidine-DNA glycosylase H2TH domain Domain
PF00641 zf-RanBP 317 → 346 Zn-finger in Ran binding protein and others Domain
PF06839 zf-GRF 505 → 550 GRF zinc finger Domain
PF06839 zf-GRF 552 → 596 GRF zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in keratinocytes and embryonic fibroblasts (at protein level). Also detected in thymus, testis and fetal lung primary fibroblasts. {ECO:0000269|PubMed:12433996, ECO:0000269|PubMed:16428305, ECO:0000269|PubMed:19426544, ECO:00
Sequence 
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDS
SQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLE
VQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDV
LMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGL
ALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTIIS
WTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVLKSEENSTVFS
HLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSP
PASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSC
NPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGENKGRQFYACPLPREAQ
CGFFEWADLSFPFCNHGKRSTMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIK
IIPGC
Sequence length 605
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Base excision repair   Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Defective Base Excision Repair Associated with NEIL3
NEIL3-mediated resolution of ICLs
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Benign rs10007075 RCV005927809
Germ cell tumor of testis Benign rs10007075 RCV005927810
Low-frequency hearing loss Uncertain significance rs1338708417 RCV002246209
Low-frequency sensorineural hearing impairment Uncertain significance rs1338708417 RCV002246209
Show/Hide Text Mining Associations (24)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32364878
Astrocytoma Associate 28378638
Carcinogenesis Associate 36233194
Carcinoma Hepatocellular Associate 34045188, 34840632, 35030478, 37923899
Carcinoma Renal Cell Associate 32364878
Cholangiocarcinoma Associate 33725402
Colorectal Neoplasms Associate 30591675
COVID 19 Associate 35927536
Diabetes Mellitus Type 2 Associate 23392254
Disease Associate 37337823