UQCC1 (ubiquinol-cytochrome c reductase complex assembly factor 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 55245
Gene name Ubiquinol-cytochrome c reductase complex assembly factor 1
Gene symbol UQCC1
Synonyms (NCBI Gene)
BFZBC20orf44CBP3UQCC
Chromosome 20
Chromosome location 20q11.22
Summary This gene encodes a transmembrane protein that is structurally similar to the mouse basic fibroblast growth factor repressed ZIC-binding protein. In mouse this protein may be involved in fibroblast growth factor regulated growth control. In humans, polymo
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT741970 hsa-miR-665 HITS-CLIP 23824327
MIRT741971 hsa-miR-590-3p HITS-CLIP 23824327
MIRT741972 hsa-miR-885-5p HITS-CLIP 23824327
MIRT741973 hsa-miR-4775 HITS-CLIP 23824327
MIRT741974 hsa-miR-587 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24385928, 32814053, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 24385928
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611797 15891 ENSG00000101019
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NVA1
Protein name Ubiquinol-cytochrome c reductase complex assembly factor 1 (Basic FGF-repressed Zic-binding protein) (bFGF-repressed Zic-binding protein) (bFZb) (Ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog)
Protein function Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex). Involved in cytochrome b translation and/or stability.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03981 Ubiq_cyt_C_chap 135 → 275 Ubiquinol-cytochrome C chaperone Family
Sequence 
MALLVRVLRNQTSISQWVPVCSRLIPVSPTQGQGDRALSRTSQWPQMSQSRACGGSEQIP
GIDIQLNRKYHTTRKLSTTKDSPQPVEEKVGAFTKIIEAMGFTGPLKYSKWKIKIAALRM
YTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMW
EDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCE
DPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL
Sequence length 299
Interactions View interactions