Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55240
Gene name Gene Name - the full gene name approved by the HGNC.
STEAP3 metalloreductase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STEAP3
Synonyms (NCBI Gene) Gene synonyms aliases
AHMIO2, STMP3, TSAP6, dudlin-2, dudulin-2, pHyde
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficienc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027494 hsa-miR-98-5p Microarray 19088304
MIRT031486 hsa-miR-16-5p Proteomics 18668040
MIRT052160 hsa-let-7b-5p CLASH 23622248
MIRT049382 hsa-miR-92a-3p CLASH 23622248
MIRT486983 hsa-miR-296-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22624035
GO:0005737 Component Cytoplasm IDA 25468996
GO:0005768 Component Endosome IBA
GO:0005768 Component Endosome IEA
GO:0005771 Component Multivesicular body IDA 15319436
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609671 24592 ENSG00000115107
Protein
UniProt ID Q658P3
Protein name Metalloreductase STEAP3 (EC 1.16.1.-) (Dudulin-2) (Six-transmembrane epithelial antigen of prostate 3) (Tumor suppressor-activated pathway protein 6) (hTSAP6) (pHyde) (hpHyde)
Protein function Integral membrane protein that functions as a NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane (PubMed:26205815). Mediates sequential t
PDB 2VNS , 2VQ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03807 F420_oxidored 30 117 NADP oxidoreductase coenzyme F420-dependent Family
PF01794 Ferric_reduct 259 406 Ferric reductase like transmembrane component Family
Tissue specificity TISSUE SPECIFICITY: Expressed in adult bone marrow, placenta, liver, skeletal muscle and pancreas. Down-regulated in hepatocellular carcinoma. {ECO:0000269|PubMed:12606722, ECO:0000269|PubMed:15885357, ECO:0000269|PubMed:16227996}.
Sequence
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN
PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNP
TEQ
EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV
QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY
LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLS
TLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA
LAEKTSHV
Sequence length 488
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  p53 signaling pathway
Ferroptosis
  TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
Transferrin endocytosis and recycling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Severe Congenital Hypochromic Anemia With Ringed Sideroblasts severe congenital hypochromic anemia with ringed sideroblasts rs587776963 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hyperopia Hyperopia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 35500219
Alzheimer Disease Associate 39394418
Anemia hypochromic microcytic Associate 38360212
Astrocytoma Associate 37980651
Carcinoma Basal Cell Associate 35501667
Carcinoma Hepatocellular Associate 36495944
Carcinoma Renal Cell Associate 33092599, 35275508
Carcinoma Renal Cell Stimulate 36424540, 37344930
Carcinoma Squamous Cell Associate 35501667
Cardiomyopathy Dilated Associate 36769209