Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55212
Gene name Gene Name - the full gene name approved by the HGNC.	Bardet-Biedl syndrome 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BBS7
Synonyms (NCBI Gene) Gene synonyms aliases	BBS2L1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q27
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of eight proteins that form the BBSome complex containing BBS1, BBS2, BBS4, BBS5, BBS7, BBS8, BBS9 and BBIP10. The BBSome complex is believed to recruit Rab8(GTP) to the primary cilium and promote ciliogenesis. The BBSome complex ass

Show/Hide all(30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111442398	T>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs114718913	T>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign	Missense variant, coding sequence variant
rs119466001	T>C	Pathogenic	Missense variant, coding sequence variant
rs119466002	G>A	Pathogenic	Missense variant, coding sequence variant
rs146617227	T>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs150743868	G>A,C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs202102193	T>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs587777812	CTTT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587777836	GGAACT>-	Pathogenic	Inframe deletion, coding sequence variant, intron variant
rs672601379	TA>G	Pathogenic	Frameshift variant, coding sequence variant
rs760165634	CTCT>-	Pathogenic	Coding sequence variant, frameshift variant
rs761403504	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs773139166	TA>-	Pathogenic	Coding sequence variant, inframe indel, stop gained
rs863224529	TGC>A	Pathogenic	Frameshift variant, coding sequence variant
rs863224530	GT>-	Pathogenic	Frameshift variant, coding sequence variant
rs869025207	G>C	Pathogenic	Coding sequence variant, missense variant
rs878853352	AG>TCT	Likely-pathogenic	Stop gained, coding sequence variant
rs886044668	->C	Pathogenic	Coding sequence variant, frameshift variant
rs991365297	A>G,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs1057519027	T>G	Conflicting-interpretations-of-pathogenicity	Splice acceptor variant
rs1221499782	C>T	Pathogenic	Missense variant, coding sequence variant
rs1233058112	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1553933472	->TT	Pathogenic	Coding sequence variant, frameshift variant
rs1560638613	C>A	Likely-pathogenic	Splice donor variant
rs1560647130	A>G	Pathogenic	Splice donor variant
rs1560658189	T>A	Pathogenic	Stop gained, coding sequence variant
rs1578522416	TGATACTTCATTTATCTCTAGAAGGAGTTGACCAGATGCAGTTAGATAAATCACTTTGATCAGAAACATTAATAATGTAACAACAACACAAAATAAACATCAGAAAGAATTATTAATTTTGTTTGTTTACCGTATGATATGTTGAGGTTAATTTTCCTTTTTGTAGCTTCTTTAGAAAGCACATCTTTTAGGATGGAGATAGTAGAAATGTTGTCAGATTTAAAAACTCCCTCTCCTTTTCTATAAAATTAATAT	Likely-pathogenic	Coding sequence variant, intron variant, splice acceptor variant, splice donor variant
rs1578537379	C>T	Likely-pathogenic	Splice donor variant
rs1578564877	->TCATAC	Pathogenic	Coding sequence variant, inframe insertion
rs1578577361	GT>-	Likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024648	hsa-miR-215-5p	Microarray	19074876
MIRT026140	hsa-miR-192-5p	Microarray	19074876
MIRT051927	hsa-let-7b-5p	CLASH	23622248
MIRT816965	hsa-miR-181a	CLIP-seq
MIRT816966	hsa-miR-181b	CLIP-seq
MIRT816967	hsa-miR-181c	CLIP-seq
MIRT816968	hsa-miR-181d	CLIP-seq
MIRT816969	hsa-miR-3144-3p	CLIP-seq
MIRT816970	hsa-miR-376a	CLIP-seq
MIRT816971	hsa-miR-376b	CLIP-seq
MIRT816972	hsa-miR-4262	CLIP-seq
MIRT816973	hsa-miR-579	CLIP-seq
MIRT816974	hsa-miR-664	CLIP-seq
MIRT816975	hsa-miR-1248	CLIP-seq
MIRT816976	hsa-miR-1302	CLIP-seq
MIRT816977	hsa-miR-1913	CLIP-seq
MIRT816978	hsa-miR-21	CLIP-seq
MIRT816979	hsa-miR-3122	CLIP-seq
MIRT816980	hsa-miR-3199	CLIP-seq
MIRT816981	hsa-miR-320a	CLIP-seq
MIRT816982	hsa-miR-320b	CLIP-seq
MIRT816983	hsa-miR-320c	CLIP-seq
MIRT816984	hsa-miR-320d	CLIP-seq
MIRT816985	hsa-miR-324-3p	CLIP-seq
MIRT816986	hsa-miR-346	CLIP-seq
MIRT816987	hsa-miR-3611	CLIP-seq
MIRT816988	hsa-miR-3913-5p	CLIP-seq
MIRT816989	hsa-miR-3940-5p	CLIP-seq
MIRT816990	hsa-miR-4298	CLIP-seq
MIRT816991	hsa-miR-4429	CLIP-seq
MIRT816992	hsa-miR-4507	CLIP-seq
MIRT816993	hsa-miR-4635	CLIP-seq
MIRT816994	hsa-miR-4699-5p	CLIP-seq
MIRT816995	hsa-miR-4709-5p	CLIP-seq
MIRT816996	hsa-miR-4712-5p	CLIP-seq
MIRT816997	hsa-miR-4724-3p	CLIP-seq
MIRT816998	hsa-miR-4803	CLIP-seq
MIRT816999	hsa-miR-494	CLIP-seq
MIRT817000	hsa-miR-526b	CLIP-seq
MIRT817001	hsa-miR-548c-3p	CLIP-seq
MIRT817002	hsa-miR-581	CLIP-seq
MIRT817003	hsa-miR-587	CLIP-seq
MIRT817004	hsa-miR-590-3p	CLIP-seq
MIRT817005	hsa-miR-590-5p	CLIP-seq
MIRT817006	hsa-miR-627	CLIP-seq
MIRT817007	hsa-miR-770-5p	CLIP-seq
MIRT817008	hsa-miR-885-5p	CLIP-seq
MIRT817009	hsa-miR-890	CLIP-seq
MIRT817010	hsa-miR-9	CLIP-seq
MIRT817011	hsa-miR-924	CLIP-seq
MIRT817012	hsa-miR-938	CLIP-seq
MIRT1920277	hsa-miR-128	CLIP-seq
MIRT1920278	hsa-miR-144	CLIP-seq
MIRT1920279	hsa-miR-27a	CLIP-seq
MIRT1920280	hsa-miR-27b	CLIP-seq
MIRT1920281	hsa-miR-4760-3p	CLIP-seq
MIRT1920277	hsa-miR-128	CLIP-seq
MIRT1920278	hsa-miR-144	CLIP-seq
MIRT1920279	hsa-miR-27a	CLIP-seq
MIRT1920280	hsa-miR-27b	CLIP-seq
MIRT1920281	hsa-miR-4760-3p	CLIP-seq
MIRT1941578	hsa-miR-3671	CLIP-seq
MIRT2180370	hsa-miR-374c	CLIP-seq
MIRT2180371	hsa-miR-655	CLIP-seq
MIRT2444656	hsa-miR-3152-5p	CLIP-seq
MIRT2444657	hsa-miR-362-5p	CLIP-seq
MIRT2444658	hsa-miR-4477a	CLIP-seq
MIRT2444659	hsa-miR-4774-3p	CLIP-seq
MIRT2444660	hsa-miR-500b	CLIP-seq
MIRT2444661	hsa-miR-501-5p	CLIP-seq
MIRT2444662	hsa-miR-513a-3p	CLIP-seq
MIRT2483741	hsa-miR-127-5p	CLIP-seq
MIRT2483742	hsa-miR-1323	CLIP-seq
MIRT2483743	hsa-miR-142-5p	CLIP-seq
MIRT2483744	hsa-miR-155	CLIP-seq
MIRT2483745	hsa-miR-203	CLIP-seq
MIRT2483746	hsa-miR-204	CLIP-seq
MIRT2483747	hsa-miR-2054	CLIP-seq
MIRT816978	hsa-miR-21	CLIP-seq
MIRT2483748	hsa-miR-211	CLIP-seq
MIRT2483749	hsa-miR-3137	CLIP-seq
MIRT2483750	hsa-miR-3163	CLIP-seq
MIRT2483751	hsa-miR-3182	CLIP-seq
MIRT2483752	hsa-miR-3200-3p	CLIP-seq
MIRT816981	hsa-miR-320a	CLIP-seq
MIRT816982	hsa-miR-320b	CLIP-seq
MIRT816983	hsa-miR-320c	CLIP-seq
MIRT816984	hsa-miR-320d	CLIP-seq
MIRT2483753	hsa-miR-340	CLIP-seq
MIRT816987	hsa-miR-3611	CLIP-seq
MIRT2483754	hsa-miR-3614-3p	CLIP-seq
MIRT2483755	hsa-miR-3618	CLIP-seq
MIRT1941578	hsa-miR-3671	CLIP-seq
MIRT2483756	hsa-miR-3686	CLIP-seq
MIRT2180370	hsa-miR-374c	CLIP-seq
MIRT2483757	hsa-miR-3924	CLIP-seq
MIRT2483758	hsa-miR-3938	CLIP-seq
MIRT2483759	hsa-miR-410	CLIP-seq
MIRT816991	hsa-miR-4429	CLIP-seq
MIRT2483760	hsa-miR-4517	CLIP-seq
MIRT2483761	hsa-miR-4666-5p	CLIP-seq
MIRT816994	hsa-miR-4699-5p	CLIP-seq
MIRT816995	hsa-miR-4709-5p	CLIP-seq
MIRT2483762	hsa-miR-4742-3p	CLIP-seq
MIRT2483763	hsa-miR-4755-5p	CLIP-seq
MIRT2483764	hsa-miR-4780	CLIP-seq
MIRT2483765	hsa-miR-4786-3p	CLIP-seq
MIRT816998	hsa-miR-4803	CLIP-seq
MIRT816999	hsa-miR-494	CLIP-seq
MIRT2483766	hsa-miR-518a-3p	CLIP-seq
MIRT2483767	hsa-miR-518b	CLIP-seq
MIRT2483768	hsa-miR-518c	CLIP-seq
MIRT2483769	hsa-miR-518d-3p	CLIP-seq
MIRT2483770	hsa-miR-518f	CLIP-seq
MIRT2483771	hsa-miR-548aa	CLIP-seq
MIRT2483772	hsa-miR-548ag	CLIP-seq
MIRT2483773	hsa-miR-548ai	CLIP-seq
MIRT817001	hsa-miR-548c-3p	CLIP-seq
MIRT2483774	hsa-miR-548o	CLIP-seq
MIRT817002	hsa-miR-581	CLIP-seq
MIRT817003	hsa-miR-587	CLIP-seq
MIRT817004	hsa-miR-590-3p	CLIP-seq
MIRT817005	hsa-miR-590-5p	CLIP-seq
MIRT2483775	hsa-miR-623	CLIP-seq
MIRT2180371	hsa-miR-655	CLIP-seq
MIRT817008	hsa-miR-885-5p	CLIP-seq
MIRT816978	hsa-miR-21	CLIP-seq
MIRT816981	hsa-miR-320a	CLIP-seq
MIRT816982	hsa-miR-320b	CLIP-seq
MIRT816983	hsa-miR-320c	CLIP-seq
MIRT816984	hsa-miR-320d	CLIP-seq
MIRT816991	hsa-miR-4429	CLIP-seq
MIRT2483762	hsa-miR-4742-3p	CLIP-seq
MIRT816998	hsa-miR-4803	CLIP-seq
MIRT816999	hsa-miR-494	CLIP-seq
MIRT2483771	hsa-miR-548aa	CLIP-seq
MIRT817003	hsa-miR-587	CLIP-seq
MIRT817005	hsa-miR-590-5p	CLIP-seq
MIRT817008	hsa-miR-885-5p	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001654	Process	Eye development	IEA
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001947	Process	Heart looping	ISS
GO:0005515	Function	Protein binding	IPI	16327777, 17574030, 18000879, 18762586, 20080638, 20195357, 22500027, 24550735, 25552655, 27173435, 28514442, 29039417, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IBA
GO:0005930	Component	Axoneme	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IPI	22302990
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007368	Process	Determination of left/right symmetry	ISS
GO:0007420	Process	Brain development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007601	Process	Visual perception	IEA
GO:0008104	Process	Intracellular protein localization	IBA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0032402	Process	Melanosome transport	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IPI	22302990
GO:0034451	Component	Centriolar satellite	IEA
GO:0034464	Component	BBSome	IBA
GO:0034464	Component	BBSome	IDA	17574030, 20080638, 24550735
GO:0034464	Component	BBSome	IEA
GO:0034464	Component	BBSome	IPI	19081074
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0046907	Process	Intracellular transport	IBA
GO:0048546	Process	Digestive tract morphogenesis	ISS
GO:0051877	Process	Pigment granule aggregation in cell center	ISS
GO:0060170	Component	Ciliary membrane	IDA	19081074
GO:0060170	Component	Ciliary membrane	IEA
GO:0060173	Process	Limb development	IEA
GO:0060271	Process	Cilium assembly	IBA
GO:0060271	Process	Cilium assembly	ISS
GO:0060271	Process	Cilium assembly	NAS	19081074
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22302990
GO:1903929	Process	Primary palate development	IEA
GO:1905515	Process	Non-motile cilium assembly	IEA

MIM	HGNC	e!Ensembl
607590	18758	ENSG00000138686

Protein

UniProt ID

Q8IWZ6

Protein name

BBSome complex member BBS7 (BBS2-like protein 1) (Bardet-Biedl syndrome 7 protein)

Protein function

The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is ubiquitously expressed. Isoform 1 is expressed in retina, lung, liver, testis, ovary, prostate, small intestine, liver, brain, heart and pancreas.

Sequence

MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKT
LPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSD
LFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDV
MYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGG
ILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKD
SYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQER
ENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDV
DKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKT
CQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGEC
VTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEV
SVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEY
KKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA

Sequence length

715

Interactions

View interactions

	Reactome
			BBSome-mediated cargo-targeting to cilium

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Bardet-Biedl Syndrome	bardet-biedl syndrome, bardet-biedl syndrome 7, Bardet-Biedl syndrome 1	rs762782183, rs863224530, rs773139166, rs1470030897, rs119466002, rs869025207, rs886044668, rs1578537379, rs587777812, rs1560664459, rs1057519027, rs587777836, rs1578577361, rs878853352, rs1578522416 View all (13 more)	N/A
retinal dystrophy	Retinal dystrophy	rs1560664459, rs869025207, rs878853352, rs762782183, rs760165634, rs119466001	N/A
Optic Atrophy	optic atrophy	rs672601379	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Psoriasis	Psoriasis	N/A	N/A	GWAS
Retinitis Pigmentosa	retinitis pigmentosa	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Amelogenesis imperfecta local hypoplastic form	Associate	36672825
Anodontia	Associate	36672825
Bardet Biedl Syndrome	Associate	12567324, 12677556, 26325687, 28761321, 34146953, 36672825, 37293956
Capillary Malformation Arteriovenous Malformation	Associate	36672825
Coxa Valga	Associate	36672825
Hydronephrosis	Associate	36672825
Multicystic renal dysplasia bilateral	Associate	36672825
Myopia	Associate	36672825
Neointima	Associate	36672825
Obesity	Associate	36672825
Polydactyly	Associate	36672825
Pyometra	Associate	36672825
Retinitis Pigmentosa	Associate	36672825
Taurodontism	Associate	36672825
Vaginitis	Associate	36672825

BBS7 (Bardet-Biedl syndrome 7)