MAP1S (microtubule associated protein 1S)

Gene

• Entrez ID: 55201
• Gene name: Microtubule associated protein 1S
• Gene symbol: MAP1S
• Synonyms (NCBI Gene): BPY2IP1, C19orf5, MAP8, VCY2IP-1, VCY2IP1
• Chromosome: 19
• Chromosome location: 19p13.11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042810	hsa-miR-339-5p	CLASH	23622248
MIRT041005	hsa-miR-505-3p	CLASH	23622248
MIRT038459	hsa-miR-296-3p	CLASH	23622248
MIRT2036281	hsa-miR-128	CLIP-seq
MIRT2036282	hsa-miR-27a	CLIP-seq
MIRT2036283	hsa-miR-27b	CLIP-seq
MIRT2036284	hsa-miR-4474-3p	CLIP-seq
MIRT2036285	hsa-miR-4502	CLIP-seq
MIRT2036286	hsa-miR-4762-3p	CLIP-seq
MIRT2036281	hsa-miR-128	CLIP-seq
MIRT2036282	hsa-miR-27a	CLIP-seq
MIRT2036283	hsa-miR-27b	CLIP-seq
MIRT2036284	hsa-miR-4474-3p	CLIP-seq
MIRT2036285	hsa-miR-4502	CLIP-seq
MIRT2036286	hsa-miR-4762-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0001578	Process	Microtubule bundle formation	IMP	15528209
GO:0003677	Function	DNA binding	IDA	15907802
GO:0003677	Function	DNA binding	IEA
GO:0003779	Function	Actin binding	IBA
GO:0004536	Function	DNA nuclease activity	IDA	15907802
GO:0005515	Function	Protein binding	IPI	12762840, 14627543, 15907802, 17658481, 19027008
GO:0005634	Component	Nucleus	IDA	12762840
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17234756
GO:0005815	Component	Microtubule organizing center	IDA	17234756
GO:0005819	Component	Spindle	IDA	18445686
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12762840
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	15528209, 17658481, 18445686
GO:0005874	Component	Microtubule	IEA
GO:0005875	Component	Microtubule associated complex	IBA
GO:0006914	Process	Autophagy	TAS	21262964
GO:0006915	Process	Apoptotic process	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	17234756
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS	16297881
GO:0007409	Process	Axonogenesis	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS	15528209
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	15528209
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	TAS	12762840
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0015631	Function	Tubulin binding	IDA	15528209
GO:0015631	Function	Tubulin binding	IEA
GO:0016358	Process	Dendrite development	IBA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS	15528209
GO:0031114	Process	Regulation of microtubule depolymerization	IBA
GO:0034454	Process	Microtubule anchoring at centrosome	IMP	17234756
GO:0042802	Function	Identical protein binding	IEA
GO:0042995	Component	Cell projection	IDA	17658481
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS	15528209
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IDA	17658481
GO:0047497	Process	Mitochondrion transport along microtubule	TAS	12762840
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12762840
GO:0048487	Function	Beta-tubulin binding	IDA	12762840
GO:0048812	Process	Neuron projection morphogenesis	IEP	15528209
GO:0051015	Function	Actin filament binding	IDA	12762840
GO:0051015	Function	Actin filament binding	IDA	15528209
GO:0051310	Process	Metaphase chromosome alignment	IMP	17234756
GO:1990498	Component	Mitotic spindle microtubule	IDA	17234756

Other IDs

• MIM: 607573
• HGNC: 15715
• e!Ensembl: ENSG00000130479

Protein

• UniProt ID: Q66K74
• Protein name: Microtubule-associated protein 1S (MAP-1S) (BPY2-interacting protein 1) (Microtubule-associated protein 8) (Variable charge Y chromosome 2-interacting protein 1) (VCY2-interacting protein 1) (VCY2IP-1) [Cleaved into: MAP1S heavy chain; MAP1S light chain]
• Protein function: Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule organizing center to the centrosomes. Binds to DNA. Plays a role in apopto
• Tissue specificity: TISSUE SPECIFICITY: Expressed in neurons (at protein level). Expressed in spermatocytes, spermatids and spermatozoa. Expressed in the cerebral cortex. Highly expressed in testis. Moderately expressed in the brain, colon, heart, kidney, liver, lung, placen
• Sequence:

  MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVF
  VSRHSATFSSIVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGP
  CLEETGELLLQTGGFSPHHFLQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAP
  AVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFELLEPPTSGGFLRLGR
  PCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHPGADSLPG
  LNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLARGEDEAELALS
  LLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHP
  AGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRD
  SSKREGLLATHPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPRE
  VRRAASSVPNLKKTNAQAAPKPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGS
  PASQLVATPSLELGPIPAGEEKALELPLAASSIPRPRTPSPESHRSPAEGSERLSLSPLR
  GGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPSAPTSEAGLSLP
  LRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARSQERAGGLGAE
  ETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSI
  CMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLS
  ARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSA
  HLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAM
  HTWYAETHARHQALGITVLGSNSMVSMQDDAFPACKVEF

• Sequence length: 1059

Pathways

KEGG:

Viral life cycle - HIV-1