Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	552
Gene name Gene Name - the full gene name approved by the HGNC.	Arginine vasopressin receptor 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AVPR1A
Synonyms (NCBI Gene) Gene synonyms aliases	AVPR V1a, AVPR1, V1aR
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosph

Show/Hide all(132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT620542	hsa-miR-1276	HITS-CLIP	23824327
MIRT620541	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT620540	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT620539	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT620538	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT620537	hsa-miR-8073	HITS-CLIP	23824327
MIRT620536	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT620535	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT620534	hsa-miR-3128	HITS-CLIP	23824327
MIRT620533	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT620532	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT620531	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT620530	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT620529	hsa-miR-4252	HITS-CLIP	23824327
MIRT620528	hsa-miR-4470	HITS-CLIP	23824327
MIRT620527	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT620526	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT620525	hsa-miR-7703	HITS-CLIP	23824327
MIRT499852	hsa-miR-8084	PAR-CLIP	22012620
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT499849	hsa-miR-429	PAR-CLIP	22012620
MIRT499848	hsa-miR-944	PAR-CLIP	22012620
MIRT499846	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT499847	hsa-miR-5692b	PAR-CLIP	22012620
MIRT499845	hsa-miR-5692c	PAR-CLIP	22012620
MIRT499844	hsa-miR-126-5p	PAR-CLIP	22012620
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT499852	hsa-miR-8084	PAR-CLIP	24398324
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT499849	hsa-miR-429	PAR-CLIP	24398324
MIRT499848	hsa-miR-944	PAR-CLIP	24398324
MIRT499846	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT499847	hsa-miR-5692b	PAR-CLIP	24398324
MIRT499845	hsa-miR-5692c	PAR-CLIP	24398324
MIRT499844	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT443624	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT443623	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT443622	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT443621	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT443620	hsa-miR-1244	PAR-CLIP	22100165
MIRT443619	hsa-miR-8063	PAR-CLIP	22100165
MIRT443618	hsa-miR-4698	PAR-CLIP	22100165
MIRT443617	hsa-miR-5697	PAR-CLIP	22100165
MIRT443616	hsa-miR-4480	PAR-CLIP	22100165
MIRT443614	hsa-miR-607	PAR-CLIP	22100165
MIRT499844	hsa-miR-126-5p	PAR-CLIP	27292025
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	27292025
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	27292025
MIRT499846	hsa-miR-369-3p	PAR-CLIP	27292025
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	27292025
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	27292025
MIRT499849	hsa-miR-429	PAR-CLIP	27292025
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	27292025
MIRT499847	hsa-miR-5692b	PAR-CLIP	27292025
MIRT499845	hsa-miR-5692c	PAR-CLIP	27292025
MIRT499852	hsa-miR-8084	PAR-CLIP	27292025
MIRT499848	hsa-miR-944	PAR-CLIP	27292025
MIRT620542	hsa-miR-1276	HITS-CLIP	23824327
MIRT620541	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT620540	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT620539	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT620538	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT620537	hsa-miR-8073	HITS-CLIP	23824327
MIRT620536	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT620535	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT620534	hsa-miR-3128	HITS-CLIP	23824327
MIRT620533	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT620532	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT620531	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT620530	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT620529	hsa-miR-4252	HITS-CLIP	23824327
MIRT620528	hsa-miR-4470	HITS-CLIP	23824327
MIRT620527	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT620526	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT620525	hsa-miR-7703	HITS-CLIP	23824327
MIRT499852	hsa-miR-8084	PAR-CLIP	22012620
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT499849	hsa-miR-429	PAR-CLIP	22012620
MIRT499848	hsa-miR-944	PAR-CLIP	22012620
MIRT499846	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT499847	hsa-miR-5692b	PAR-CLIP	22012620
MIRT499845	hsa-miR-5692c	PAR-CLIP	22012620
MIRT499844	hsa-miR-126-5p	PAR-CLIP	22012620
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT499852	hsa-miR-8084	PAR-CLIP	24398324
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT499849	hsa-miR-429	PAR-CLIP	24398324
MIRT499848	hsa-miR-944	PAR-CLIP	24398324
MIRT499846	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT499847	hsa-miR-5692b	PAR-CLIP	24398324
MIRT499845	hsa-miR-5692c	PAR-CLIP	24398324
MIRT499844	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT443624	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT443623	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT443622	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT443621	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT443620	hsa-miR-1244	PAR-CLIP	22100165
MIRT443619	hsa-miR-8063	PAR-CLIP	22100165
MIRT443618	hsa-miR-4698	PAR-CLIP	22100165
MIRT443617	hsa-miR-5697	PAR-CLIP	22100165
MIRT443616	hsa-miR-4480	PAR-CLIP	22100165
MIRT443614	hsa-miR-607	PAR-CLIP	22100165
MIRT812333	hsa-miR-1229	CLIP-seq
MIRT812334	hsa-miR-1238	CLIP-seq
MIRT812335	hsa-miR-141	CLIP-seq
MIRT812336	hsa-miR-194	CLIP-seq
MIRT812337	hsa-miR-200a	CLIP-seq
MIRT812338	hsa-miR-219-2-3p	CLIP-seq
MIRT812339	hsa-miR-2964a-3p	CLIP-seq
MIRT812340	hsa-miR-3183	CLIP-seq
MIRT812341	hsa-miR-4291	CLIP-seq
MIRT812342	hsa-miR-4310	CLIP-seq
MIRT812343	hsa-miR-4723-3p	CLIP-seq
MIRT812344	hsa-miR-4731-3p	CLIP-seq
MIRT812345	hsa-miR-4801	CLIP-seq
MIRT812346	hsa-miR-485-3p	CLIP-seq
MIRT1940246	hsa-miR-4701-5p	CLIP-seq
MIRT1940247	hsa-miR-588	CLIP-seq

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0002125	Process	Maternal aggressive behavior	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IBA
GO:0005000	Function	Vasopressin receptor activity	IDA	9322919
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	TAS	10858434
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	TAS	10858434
GO:0005515	Function	Protein binding	IPI	18402937, 29386406
GO:0005768	Component	Endosome	IDA	14757828
GO:0005768	Component	Endosome	TAS	10858434
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14757828
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8838314, 10858434
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	8106369
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9322919
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10858434
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8106369
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0008015	Process	Blood circulation	TAS	8106369
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014902	Process	Myotube differentiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030139	Component	Endocytic vesicle	IDA	14757828
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IEA
GO:0031894	Function	V1A vasopressin receptor binding	IEA
GO:0032849	Process	Positive regulation of cellular pH reduction	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0035176	Process	Social behavior	IEA
GO:0042631	Process	Cellular response to water deprivation	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042713	Process	Sperm ejaculation	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051970	Process	Negative regulation of transmission of nerve impulse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653

MIM	HGNC	e!Ensembl
600821	895	ENSG00000166148

Protein

UniProt ID

P37288

Protein name

Vasopressin V1a receptor (V1aR) (AVPR V1a) (Antidiuretic hormone receptor 1a) (Vascular/hepatic-type arginine vasopressin receptor)

Protein function

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment. {ECO:

PDB

1YTV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	68 → 348	7 transmembrane receptor (rhodopsin family)	Family
PF08983	DUF1856	372 → 418	Domain of unknown function (DUF1856)	Domain

Sequence

MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST

Sequence length

418

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Vascular smooth muscle contraction		Vasopressin-like receptors G alpha (q) signalling events Defective AVP does not bind AVPR1A,B and causes neurohypophyseal diabetes insipidus (NDI)

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Autism Spectrum Disorder	autism spectrum disorder	N/A	N/A	GenCC

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Pain	Associate	31710639
Anemia Sickle Cell	Associate	31710639
Autism Spectrum Disorder	Associate	27027249, 28808521, 29309996
Autistic Disorder	Associate	18490926, 22764113, 28808521
Carcinoma Non Small Cell Lung	Associate	16043261
Carcinoma Small Cell	Associate	9357056
Communication Disorders	Associate	24849541
Depressive Disorder	Associate	24373571
Dyslexia Acquired	Associate	24849541
Essential Hypertension	Associate	12358153
Hypertension	Associate	31053625
Kinesiophobia	Associate	24373571
Language Disorders	Associate	24849541
Myocardial Infarction	Associate	29182374
Neurologic Manifestations	Associate	28808521
Obstetric Labor Complications	Associate	37373400
Pain	Associate	25599310, 26945673, 31710639
Paraganglioma	Associate	35203352
Personality Disorders	Associate	34161896
Polycystic Ovary Syndrome	Associate	39501331
Pre Eclampsia	Associate	31138298
Psychotic Disorders	Stimulate	37373400
Shoulder Pain	Associate	24373571
Small Cell Lung Carcinoma	Associate	15613460
Speech Sound Disorder	Associate	24849541
Thyroid Neoplasms	Associate	32337286

AVPR1A (arginine vasopressin receptor 1A)