Gene Gene information from NCBI Gene database.
Entrez ID 5519
Gene name Protein phosphatase 2 scaffold subunit Abeta
Gene symbol PPP2R1B
Synonyms (NCBI Gene)
PP2A-AbetaPR65B
Chromosome 11
Chromosome location 11q23.1
Summary This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1805076 C>T Pathogenic Intron variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
701
miRTarBase ID miRNA Experiments Reference
MIRT022210 hsa-miR-124-3p Microarray 18668037
MIRT025691 hsa-miR-7-5p Microarray 19073608
MIRT051305 hsa-miR-16-5p CLASH 23622248
MIRT042516 hsa-miR-423-3p CLASH 23622248
MIRT608587 hsa-miR-4307 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IBA
GO:0005515 Function Protein binding IPI 8392071, 16456541, 17540176, 18715871, 18782753, 19156129, 21172653, 23555304, 26496610, 28330616, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603113 9303 ENSG00000137713
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P30154
Protein name Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (PP2A subunit A isoform PR65-beta) (PP2A subunit A isoform R1-beta)
Protein function The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02985 HEAT 178 208 HEAT repeat Repeat
PF13646 HEAT_2 217 319 Family
PF13646 HEAT_2 378 479 Family
Sequence
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVL
ELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVK
ELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM
K
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
Sequence length 601
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mRNA surveillance pathway
Sphingolipid signaling pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TGF-beta signaling pathway
Hippo signaling pathway
Tight junction
T cell receptor signaling pathway
Dopaminergic synapse
Long-term depression
Chagas disease
Hepatitis C
Human papillomavirus infection
  Inhibition of replication initiation of damaged DNA by RB1/E2F1
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
DARPP-32 events
Degradation of beta-catenin by the destruction complex
Beta-catenin phosphorylation cascade
ERK/MAPK targets
ERKs are inactivated
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
CTLA4 inhibitory signaling
Platelet sensitization by LDL
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Misspliced GSK3beta mutants stabilize beta-catenin
S33 mutants of beta-catenin aren't phosphorylated
S37 mutants of beta-catenin aren't phosphorylated
S45 mutants of beta-catenin aren't phosphorylated
T41 mutants of beta-catenin aren't phosphorylated
APC truncation mutants have impaired AXIN binding
AXIN missense mutants destabilize the destruction complex
Truncations of AMER1 destabilize the destruction complex
RHO GTPases Activate Formins
RAF activation
Negative regulation of MAPK pathway
Regulation of TP53 Degradation
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Mitotic Prometaphase
Cyclin D associated events in G1
Cyclin A/B1/B2 associated events during G2/M transition
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung carcinoma Pathogenic rs1805076 RCV000007000
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Likely benign rs115287852 RCV005936819
Hepatocellular carcinoma Likely benign rs115287852 RCV005936820
PPP2R1B-related disorder Likely benign; Benign rs61756429, rs145742091, rs115287852, rs45568137, rs200059018, rs756932481 RCV003929036
RCV003923896
RCV003904189
RCV003964462
RCV003959584
RCV003929525
Uterine corpus endometrial carcinoma Likely benign rs115287852 RCV005936821
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 10896920, 10935485
Dermatitis Herpetiformis Associate 22991566
Endometrial Neoplasms Associate 33754208
Lung Neoplasms Associate 10896920
Neoplasms Inhibit 10896920, 17343570
Neoplasms Associate 10935485, 31253108, 40178903