Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5518
Gene name	Protein phosphatase 2 scaffold subunit Aalpha
Gene symbol	PPP2R1A
Synonyms (NCBI Gene)	HJS2MRD36PP2A-AalphaPP2AAPP2AAALPHAPR65A
Chromosome	19
Chromosome location	19q13.41
Summary	This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786205227	C>T	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs786205228	C>G,T	Likely-pathogenic, pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
rs863225094	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1057519946	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519947	G>A	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1555791268	C>T	Uncertain-significance, likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant

300

Show/Hide all (300)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031709	hsa-miR-16-5p	Proteomics	18668040
MIRT051517	hsa-let-7e-5p	CLASH	23622248
MIRT050961	hsa-miR-17-5p	CLASH	23622248
MIRT050575	hsa-miR-20a-5p	CLASH	23622248
MIRT050575	hsa-miR-20a-5p	CLASH	23622248
MIRT049765	hsa-miR-92a-3p	CLASH	23622248
MIRT048343	hsa-miR-106a-5p	CLASH	23622248
MIRT046765	hsa-miR-222-3p	CLASH	23622248
MIRT037954	hsa-miR-505-5p	CLASH	23622248
MIRT036561	hsa-miR-941	CLASH	23622248
MIRT639556	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639555	hsa-miR-1279	HITS-CLIP	23824327
MIRT639554	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639553	hsa-miR-4775	HITS-CLIP	23824327
MIRT639552	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT639551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT639556	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639555	hsa-miR-1279	HITS-CLIP	23824327
MIRT639554	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639553	hsa-miR-4775	HITS-CLIP	23824327
MIRT639552	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT639551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1257294	hsa-miR-1275	CLIP-seq
MIRT1257295	hsa-miR-150	CLIP-seq
MIRT1257296	hsa-miR-1915	CLIP-seq
MIRT1257297	hsa-miR-2277-3p	CLIP-seq
MIRT1257298	hsa-miR-2861	CLIP-seq
MIRT1257299	hsa-miR-3120-3p	CLIP-seq
MIRT1257300	hsa-miR-3127-3p	CLIP-seq
MIRT1257301	hsa-miR-3150a-3p	CLIP-seq
MIRT1257302	hsa-miR-3175	CLIP-seq
MIRT1257303	hsa-miR-3179	CLIP-seq
MIRT1257304	hsa-miR-3202	CLIP-seq
MIRT1257305	hsa-miR-3667-3p	CLIP-seq
MIRT1257306	hsa-miR-3914	CLIP-seq
MIRT1257307	hsa-miR-3928	CLIP-seq
MIRT1257308	hsa-miR-3943	CLIP-seq
MIRT1257309	hsa-miR-3974	CLIP-seq
MIRT1257310	hsa-miR-4270	CLIP-seq
MIRT1257311	hsa-miR-4271	CLIP-seq
MIRT1257312	hsa-miR-4323	CLIP-seq
MIRT1257313	hsa-miR-4441	CLIP-seq
MIRT1257314	hsa-miR-4505	CLIP-seq
MIRT1257315	hsa-miR-4525	CLIP-seq
MIRT1257316	hsa-miR-4665-5p	CLIP-seq
MIRT1257317	hsa-miR-4667-5p	CLIP-seq
MIRT1257318	hsa-miR-4691-5p	CLIP-seq
MIRT1257319	hsa-miR-4700-5p	CLIP-seq
MIRT1257320	hsa-miR-4723-5p	CLIP-seq
MIRT1257321	hsa-miR-4725-3p	CLIP-seq
MIRT1257322	hsa-miR-4726-3p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT1257324	hsa-miR-4747-5p	CLIP-seq
MIRT1257325	hsa-miR-542-3p	CLIP-seq
MIRT1257326	hsa-miR-615-5p	CLIP-seq
MIRT1257327	hsa-miR-625	CLIP-seq
MIRT1257328	hsa-miR-637	CLIP-seq
MIRT1257329	hsa-miR-661	CLIP-seq
MIRT1257330	hsa-miR-885-5p	CLIP-seq
MIRT1257331	hsa-miR-939	CLIP-seq
MIRT2075852	hsa-miR-1208	CLIP-seq
MIRT2075853	hsa-miR-1236	CLIP-seq
MIRT1257294	hsa-miR-1275	CLIP-seq
MIRT1257296	hsa-miR-1915	CLIP-seq
MIRT2075854	hsa-miR-199a-5p	CLIP-seq
MIRT2075855	hsa-miR-199b-5p	CLIP-seq
MIRT1257298	hsa-miR-2861	CLIP-seq
MIRT1257301	hsa-miR-3150a-3p	CLIP-seq
MIRT2075856	hsa-miR-3151	CLIP-seq
MIRT1257302	hsa-miR-3175	CLIP-seq
MIRT1257303	hsa-miR-3179	CLIP-seq
MIRT1257304	hsa-miR-3202	CLIP-seq
MIRT2075857	hsa-miR-3682-5p	CLIP-seq
MIRT2075858	hsa-miR-3684	CLIP-seq
MIRT1257306	hsa-miR-3914	CLIP-seq
MIRT1257307	hsa-miR-3928	CLIP-seq
MIRT2075859	hsa-miR-3940-3p	CLIP-seq
MIRT1257309	hsa-miR-3974	CLIP-seq
MIRT2075860	hsa-miR-4265	CLIP-seq
MIRT2075861	hsa-miR-4268	CLIP-seq
MIRT1257311	hsa-miR-4271	CLIP-seq
MIRT2075862	hsa-miR-4296	CLIP-seq
MIRT2075863	hsa-miR-4305	CLIP-seq
MIRT2075864	hsa-miR-4322	CLIP-seq
MIRT2075865	hsa-miR-4421	CLIP-seq
MIRT2075866	hsa-miR-4443	CLIP-seq
MIRT2075867	hsa-miR-4447	CLIP-seq
MIRT2075868	hsa-miR-4448	CLIP-seq
MIRT2075869	hsa-miR-4472	CLIP-seq
MIRT1257314	hsa-miR-4505	CLIP-seq
MIRT1257315	hsa-miR-4525	CLIP-seq
MIRT1257316	hsa-miR-4665-5p	CLIP-seq
MIRT1257317	hsa-miR-4667-5p	CLIP-seq
MIRT1257319	hsa-miR-4700-5p	CLIP-seq
MIRT1257320	hsa-miR-4723-5p	CLIP-seq
MIRT1257321	hsa-miR-4725-3p	CLIP-seq
MIRT1257322	hsa-miR-4726-3p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT1257324	hsa-miR-4747-5p	CLIP-seq
MIRT2075870	hsa-miR-4777-5p	CLIP-seq
MIRT2075871	hsa-miR-491-5p	CLIP-seq
MIRT2075872	hsa-miR-518d-5p	CLIP-seq
MIRT2075873	hsa-miR-519b-5p	CLIP-seq
MIRT2075874	hsa-miR-519c-5p	CLIP-seq
MIRT2075875	hsa-miR-520c-5p	CLIP-seq
MIRT2075876	hsa-miR-526a	CLIP-seq
MIRT2075877	hsa-miR-606	CLIP-seq
MIRT1257327	hsa-miR-625	CLIP-seq
MIRT1257328	hsa-miR-637	CLIP-seq
MIRT1257329	hsa-miR-661	CLIP-seq
MIRT1257331	hsa-miR-939	CLIP-seq
MIRT1257294	hsa-miR-1275	CLIP-seq
MIRT1257298	hsa-miR-2861	CLIP-seq
MIRT1257299	hsa-miR-3120-3p	CLIP-seq
MIRT2302478	hsa-miR-3126-5p	CLIP-seq
MIRT2075856	hsa-miR-3151	CLIP-seq
MIRT1257303	hsa-miR-3179	CLIP-seq
MIRT1257304	hsa-miR-3202	CLIP-seq
MIRT1257306	hsa-miR-3914	CLIP-seq
MIRT1257307	hsa-miR-3928	CLIP-seq
MIRT2075860	hsa-miR-4265	CLIP-seq
MIRT1257311	hsa-miR-4271	CLIP-seq
MIRT2075862	hsa-miR-4296	CLIP-seq
MIRT2075864	hsa-miR-4322	CLIP-seq
MIRT2075866	hsa-miR-4443	CLIP-seq
MIRT2075867	hsa-miR-4447	CLIP-seq
MIRT2075869	hsa-miR-4472	CLIP-seq
MIRT1257315	hsa-miR-4525	CLIP-seq
MIRT1257316	hsa-miR-4665-5p	CLIP-seq
MIRT1257320	hsa-miR-4723-5p	CLIP-seq
MIRT1257321	hsa-miR-4725-3p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT1257324	hsa-miR-4747-5p	CLIP-seq
MIRT2075871	hsa-miR-491-5p	CLIP-seq
MIRT2302479	hsa-miR-591	CLIP-seq
MIRT1257326	hsa-miR-615-5p	CLIP-seq
MIRT1257327	hsa-miR-625	CLIP-seq
MIRT1257328	hsa-miR-637	CLIP-seq
MIRT1257329	hsa-miR-661	CLIP-seq
MIRT1257330	hsa-miR-885-5p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT2599087	hsa-miR-1178	CLIP-seq
MIRT2075852	hsa-miR-1208	CLIP-seq
MIRT2599088	hsa-miR-125a-5p	CLIP-seq
MIRT2599089	hsa-miR-125b	CLIP-seq
MIRT1257294	hsa-miR-1275	CLIP-seq
MIRT1257295	hsa-miR-150	CLIP-seq
MIRT2599090	hsa-miR-15a	CLIP-seq
MIRT2599091	hsa-miR-15b	CLIP-seq
MIRT2599092	hsa-miR-16	CLIP-seq
MIRT1257296	hsa-miR-1915	CLIP-seq
MIRT2599093	hsa-miR-195	CLIP-seq
MIRT2075854	hsa-miR-199a-5p	CLIP-seq
MIRT2075855	hsa-miR-199b-5p	CLIP-seq
MIRT2599094	hsa-miR-214	CLIP-seq
MIRT1257298	hsa-miR-2861	CLIP-seq
MIRT1257299	hsa-miR-3120-3p	CLIP-seq
MIRT2302478	hsa-miR-3126-5p	CLIP-seq
MIRT1257300	hsa-miR-3127-3p	CLIP-seq
MIRT1257301	hsa-miR-3150a-3p	CLIP-seq
MIRT2075856	hsa-miR-3151	CLIP-seq
MIRT1257302	hsa-miR-3175	CLIP-seq
MIRT1257303	hsa-miR-3179	CLIP-seq
MIRT1257304	hsa-miR-3202	CLIP-seq
MIRT2599095	hsa-miR-3613-3p	CLIP-seq
MIRT2599096	hsa-miR-361-3p	CLIP-seq
MIRT2599097	hsa-miR-3619-5p	CLIP-seq
MIRT1257305	hsa-miR-3667-3p	CLIP-seq
MIRT1257306	hsa-miR-3914	CLIP-seq
MIRT1257307	hsa-miR-3928	CLIP-seq
MIRT2075859	hsa-miR-3940-3p	CLIP-seq
MIRT1257308	hsa-miR-3943	CLIP-seq
MIRT1257309	hsa-miR-3974	CLIP-seq
MIRT2599098	hsa-miR-424	CLIP-seq
MIRT2075860	hsa-miR-4265	CLIP-seq
MIRT1257310	hsa-miR-4270	CLIP-seq
MIRT1257311	hsa-miR-4271	CLIP-seq
MIRT2599099	hsa-miR-4287	CLIP-seq
MIRT2075862	hsa-miR-4296	CLIP-seq
MIRT2599100	hsa-miR-4319	CLIP-seq
MIRT2075864	hsa-miR-4322	CLIP-seq
MIRT1257312	hsa-miR-4323	CLIP-seq
MIRT2075865	hsa-miR-4421	CLIP-seq
MIRT2599101	hsa-miR-4434	CLIP-seq
MIRT1257313	hsa-miR-4441	CLIP-seq
MIRT2075866	hsa-miR-4443	CLIP-seq
MIRT2075867	hsa-miR-4447	CLIP-seq
MIRT2599102	hsa-miR-4469	CLIP-seq
MIRT2075869	hsa-miR-4472	CLIP-seq
MIRT1257314	hsa-miR-4505	CLIP-seq
MIRT2599103	hsa-miR-4516	CLIP-seq
MIRT2599104	hsa-miR-4520a-3p	CLIP-seq
MIRT1257315	hsa-miR-4525	CLIP-seq
MIRT2599105	hsa-miR-4531	CLIP-seq
MIRT1257316	hsa-miR-4665-5p	CLIP-seq
MIRT1257317	hsa-miR-4667-5p	CLIP-seq
MIRT2599106	hsa-miR-4685-3p	CLIP-seq
MIRT1257318	hsa-miR-4691-5p	CLIP-seq
MIRT2599107	hsa-miR-4694-3p	CLIP-seq
MIRT1257319	hsa-miR-4700-5p	CLIP-seq
MIRT1257320	hsa-miR-4723-5p	CLIP-seq
MIRT1257321	hsa-miR-4725-3p	CLIP-seq
MIRT1257322	hsa-miR-4726-3p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT2599108	hsa-miR-4732-3p	CLIP-seq
MIRT1257324	hsa-miR-4747-5p	CLIP-seq
MIRT2075871	hsa-miR-491-5p	CLIP-seq
MIRT2599109	hsa-miR-497	CLIP-seq
MIRT2599110	hsa-miR-522	CLIP-seq
MIRT1257325	hsa-miR-542-3p	CLIP-seq
MIRT2599111	hsa-miR-548aa	CLIP-seq
MIRT2599112	hsa-miR-548ac	CLIP-seq
MIRT2599113	hsa-miR-548d-3p	CLIP-seq
MIRT2599114	hsa-miR-548z	CLIP-seq
MIRT2599115	hsa-miR-583	CLIP-seq
MIRT2302479	hsa-miR-591	CLIP-seq
MIRT1257326	hsa-miR-615-5p	CLIP-seq
MIRT1257327	hsa-miR-625	CLIP-seq
MIRT1257328	hsa-miR-637	CLIP-seq
MIRT2599116	hsa-miR-642b	CLIP-seq
MIRT1257329	hsa-miR-661	CLIP-seq
MIRT2599117	hsa-miR-670	CLIP-seq
MIRT2599118	hsa-miR-761	CLIP-seq
MIRT1257330	hsa-miR-885-5p	CLIP-seq
MIRT1257331	hsa-miR-939	CLIP-seq
MIRT2599087	hsa-miR-1178	CLIP-seq
MIRT2075852	hsa-miR-1208	CLIP-seq
MIRT2599088	hsa-miR-125a-5p	CLIP-seq
MIRT2599089	hsa-miR-125b	CLIP-seq
MIRT1257294	hsa-miR-1275	CLIP-seq
MIRT1257295	hsa-miR-150	CLIP-seq
MIRT2599090	hsa-miR-15a	CLIP-seq
MIRT2599091	hsa-miR-15b	CLIP-seq
MIRT2599092	hsa-miR-16	CLIP-seq
MIRT1257296	hsa-miR-1915	CLIP-seq
MIRT2599093	hsa-miR-195	CLIP-seq
MIRT2075854	hsa-miR-199a-5p	CLIP-seq
MIRT2075855	hsa-miR-199b-5p	CLIP-seq
MIRT2599094	hsa-miR-214	CLIP-seq
MIRT1257298	hsa-miR-2861	CLIP-seq
MIRT1257299	hsa-miR-3120-3p	CLIP-seq
MIRT2302478	hsa-miR-3126-5p	CLIP-seq
MIRT1257300	hsa-miR-3127-3p	CLIP-seq
MIRT1257301	hsa-miR-3150a-3p	CLIP-seq
MIRT1257302	hsa-miR-3175	CLIP-seq
MIRT1257303	hsa-miR-3179	CLIP-seq
MIRT1257304	hsa-miR-3202	CLIP-seq
MIRT2599095	hsa-miR-3613-3p	CLIP-seq
MIRT2599096	hsa-miR-361-3p	CLIP-seq
MIRT2599097	hsa-miR-3619-5p	CLIP-seq
MIRT1257305	hsa-miR-3667-3p	CLIP-seq
MIRT1257306	hsa-miR-3914	CLIP-seq
MIRT1257307	hsa-miR-3928	CLIP-seq
MIRT2075859	hsa-miR-3940-3p	CLIP-seq
MIRT1257308	hsa-miR-3943	CLIP-seq
MIRT1257309	hsa-miR-3974	CLIP-seq
MIRT2599098	hsa-miR-424	CLIP-seq
MIRT1257310	hsa-miR-4270	CLIP-seq
MIRT1257311	hsa-miR-4271	CLIP-seq
MIRT2599099	hsa-miR-4287	CLIP-seq
MIRT2599100	hsa-miR-4319	CLIP-seq
MIRT1257312	hsa-miR-4323	CLIP-seq
MIRT2075865	hsa-miR-4421	CLIP-seq
MIRT2599101	hsa-miR-4434	CLIP-seq
MIRT1257313	hsa-miR-4441	CLIP-seq
MIRT2599102	hsa-miR-4469	CLIP-seq
MIRT1257314	hsa-miR-4505	CLIP-seq
MIRT2599103	hsa-miR-4516	CLIP-seq
MIRT2599104	hsa-miR-4520a-3p	CLIP-seq
MIRT1257315	hsa-miR-4525	CLIP-seq
MIRT2599105	hsa-miR-4531	CLIP-seq
MIRT1257316	hsa-miR-4665-5p	CLIP-seq
MIRT1257317	hsa-miR-4667-5p	CLIP-seq
MIRT2599106	hsa-miR-4685-3p	CLIP-seq
MIRT1257318	hsa-miR-4691-5p	CLIP-seq
MIRT2599107	hsa-miR-4694-3p	CLIP-seq
MIRT1257319	hsa-miR-4700-5p	CLIP-seq
MIRT1257320	hsa-miR-4723-5p	CLIP-seq
MIRT1257321	hsa-miR-4725-3p	CLIP-seq
MIRT1257322	hsa-miR-4726-3p	CLIP-seq
MIRT1257323	hsa-miR-4731-5p	CLIP-seq
MIRT2599108	hsa-miR-4732-3p	CLIP-seq
MIRT1257324	hsa-miR-4747-5p	CLIP-seq
MIRT2599109	hsa-miR-497	CLIP-seq
MIRT2599110	hsa-miR-522	CLIP-seq
MIRT2599111	hsa-miR-548aa	CLIP-seq
MIRT2599112	hsa-miR-548ac	CLIP-seq
MIRT2599113	hsa-miR-548d-3p	CLIP-seq
MIRT2599114	hsa-miR-548z	CLIP-seq
MIRT2599115	hsa-miR-583	CLIP-seq
MIRT2302479	hsa-miR-591	CLIP-seq
MIRT1257326	hsa-miR-615-5p	CLIP-seq
MIRT1257327	hsa-miR-625	CLIP-seq
MIRT1257328	hsa-miR-637	CLIP-seq
MIRT2599116	hsa-miR-642b	CLIP-seq
MIRT1257329	hsa-miR-661	CLIP-seq
MIRT2599117	hsa-miR-670	CLIP-seq
MIRT2599118	hsa-miR-761	CLIP-seq
MIRT1257330	hsa-miR-885-5p	CLIP-seq
MIRT1257331	hsa-miR-939	CLIP-seq

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IDA	17055435, 17174897
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0000159	Component	Protein phosphatase type 2A complex	TAS	11007961
GO:0000775	Component	Chromosome, centromeric region	IDA	16580887
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	IDA	33243860, 34004147
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	8617797, 9847399, 9857076, 11504734, 11591705, 15525651, 15761952, 16044149, 16580887, 16764867, 17055435, 17245430, 17274953, 17374643, 17529992, 17540176, 17632056, 17974561, 18394995, 18715871, 18782753, 19156129, 19293187, 19915589, 20711181, 21075311, 21460856, 22167190, 235553
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	33243860, 34004147
GO:0005634	Component	Nucleus	IDA	30611118
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11007961
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	NAS	11007961
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	11007961
GO:0005886	Component	Plasma membrane	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9852112
GO:0007059	Process	Chromosome segregation	IDA	16580887
GO:0007059	Process	Chromosome segregation	IEA
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0015630	Component	Microtubule cytoskeleton	NAS	11007961
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11007961
GO:0016328	Component	Lateral plasma membrane	IDA	15525651
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	IDA	33243860, 34004147
GO:0030425	Component	Dendrite	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IDA	33633399
GO:0035556	Process	Intracellular signal transduction	NAS	11007961
GO:0040008	Process	Regulation of growth	NAS	11360189
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	15525651
GO:0043025	Component	Neuronal cell body	IDA	15525651
GO:0043029	Process	T cell homeostasis	IEA
GO:0043029	Process	T cell homeostasis	ISS
GO:0045202	Component	Synapse	IEA
GO:0045595	Process	Regulation of cell differentiation	NAS	11360189
GO:0046982	Function	Protein heterodimerization activity	IPI	9847399
GO:0051225	Process	Spindle assembly	IBA
GO:0051232	Process	Meiotic spindle elongation	IEA
GO:0051306	Process	Mitotic sister chromatid separation	IEA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	IBA
GO:0051754	Process	Meiotic sister chromatid cohesion, centromeric	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	9989501
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090443	Component	FAR/SIN/STRIPAK complex	IDA	18782753, 33633399
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0160232	Component	INTAC complex	IDA	33243860, 34004147, 34762484, 36869814, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	33243860, 34004147, 38570683
GO:1903538	Process	Regulation of meiotic cell cycle process involved in oocyte maturation	IEA
GO:1990405	Function	Protein antigen binding	IPI	9847399
GO:2001241	Process	Positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
605983	9302	ENSG00000105568

P30153

Protein name

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (PP2Aa) (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha)

Protein function

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit (PubMed:15525651, PubMed:16580887, PubMed:33243860, PubMed:33633399, PubMed:34004

PDB

1B3U , 2IE3 , 2IE4 , 2NPP , 2NYL , 2NYM , 2PKG , 3C5W , 3DW8 , 3K7V , 3K7W , 4I5L , 4I5N , 4LAC , 5W0W , 6IUR , 6NTS , 7CUN , 7K36 , 7PKS , 7SOY , 7YCX , 8RBX , 8RBZ , 8RC4 , 8SO0 , 8TTB , 8TWE , 8TWI , 8U1X , 8U89 , 8UWB , 8YJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02985	HEAT	166 → 196	HEAT repeat	Repeat
PF02985	HEAT	205 → 235	HEAT repeat	Repeat
PF02985	HEAT	283 → 313	HEAT repeat	Repeat

Sequence

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

Sequence length

589

Interactions

View interactions

	KEGG		Reactome
	mRNA surveillance pathway Sphingolipid signaling pathway Cell cycle Oocyte meiosis PI3K-Akt signaling pathway AMPK signaling pathway Adrenergic signaling in cardiomyocytes TGF-beta signaling pathway Hippo signaling pathway Tight junction T cell receptor signaling pathway Dopaminergic synapse Long-term depression Chagas disease Hepatitis C Human papillomavirus infection		Inhibition of replication initiation of damaged DNA by RB1/E2F1 Spry regulation of FGF signaling Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal DARPP-32 events Degradation of beta-catenin by the destruction complex Beta-catenin phosphorylation cascade ERK/MAPK targets ERKs are inactivated Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Initiation of Nuclear Envelope (NE) Reformation Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes CTLA4 inhibitory signaling Platelet sensitization by LDL Disassembly of the destruction complex and recruitment of AXIN to the membrane Misspliced GSK3beta mutants stabilize beta-catenin S33 mutants of beta-catenin aren't phosphorylated S37 mutants of beta-catenin aren't phosphorylated S45 mutants of beta-catenin aren't phosphorylated T41 mutants of beta-catenin aren't phosphorylated APC truncation mutants have impaired AXIN binding AXIN missense mutants destabilize the destruction complex Truncations of AMER1 destabilize the destruction complex Anchoring of the basal body to the plasma membrane RHO GTPases Activate Formins RAF activation Negative regulation of MAPK pathway Regulation of TP53 Degradation PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Mitotic Prometaphase Cyclin D associated events in G1 Cyclin A/B1/B2 associated events during G2/M transition AURKA Activation by TPX2 EML4 and NUDC in mitotic spindle formation Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Show/Hide Causal Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Colon adenocarcinoma	Likely pathogenic; Pathogenic	rs1057519946	RCV005900737
Houge-Janssens syndrome 2	Pathogenic; Likely pathogenic	rs2122334663, rs2122337413, rs786205228, rs786205227, rs863225094, rs1600167934, rs2514079238, rs2514094817, rs1978897991, rs546812521, rs1057519946, rs1057519947, rs1555791268, rs1600167941	RCV003232383 RCV005868326 RCV002273041 RCV000170500 RCV000170501 RCV000201504 RCV003128303 RCV003219209 RCV003232037 RCV003232039 RCV004556964 RCV000761600 RCV001262898 RCV000824836 RCV003232134
Intellectual disability	Likely pathogenic; Pathogenic	rs1057519947	RCV002225611
Neoplasm	Likely pathogenic	rs546812521	RCV005230633
Neurodevelopmental disorder	Likely pathogenic	rs2122334423	RCV001374923
PPP2R1A-related disorder	Pathogenic; Likely pathogenic	rs786205228, rs1555791268, rs1600167941	RCV004725019 RCV003987626 RCV000844990
PPP2R1A-related neurodevelopmental disorders	Pathogenic	rs786205228	RCV001249733
See cases	Likely pathogenic	rs1600167941	RCV001420230

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs8100816	RCV005921189
Autism spectrum disorder	Uncertain significance	rs2514107396	RCV003127365
Familial cancer of breast	Likely benign	rs187141962	RCV005923916
Uterine corpus endometrial carcinoma	-	rs2122267908	RCV005922448

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	34716204
Ataxia Telangiectasia	Associate	34933911
Breast Diseases	Associate	19890961
Breast Neoplasms	Associate	19890961
Carcinogenesis	Associate	27469332, 31142515
Carcinoma Endometrioid	Associate	21435433
Carcinoma Hepatocellular	Associate	23555712, 27023146
Carcinoma Renal Cell	Associate	28004769, 28718916
Carcinoma Squamous Cell	Associate	25072932
Carcinosarcoma	Associate	22653804, 28292439, 28940304, 32114514
Colorectal Neoplasms	Associate	27023146, 34476575
Cystic Fibrosis	Associate	22892532
Developmental Disabilities	Associate	37761890, 37762002
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	22653804
Endometrial Hyperplasia	Associate	27272709
Endometrial Neoplasms	Associate	22653804, 22923510, 27272709, 28485815, 31142515, 34831139, 35128859, 36454788, 37890416, 38536067
Epilepsy	Associate	37761890, 37762002
Feeding and Eating Disorders	Associate	37761890
Gastrointestinal Stromal Tumors	Associate	27469332
Hypersensitivity Delayed	Associate	37761890
Intellectual Disability	Associate	34716204, 37762002
Leukemia	Associate	27611305
Lung Neoplasms	Associate	24204789
Megalencephaly	Associate	37761890
Meningioma	Associate	36203966
Microcephaly	Associate	37761890, 37762002
Muscle Hypotonia	Associate	37761890
Neoplasm Metastasis	Associate	27023146, 31142515
Neoplasms	Inhibit	20826764, 23493267, 32071079
Neoplasms	Associate	24425774, 24671188, 26392535, 27272709, 27469332, 27791010, 28489996, 30485824, 30508944, 31142515, 31541192, 34933911, 38369189
Neoplasms Cystic Mucinous and Serous	Associate	21435433, 22653804, 22923510
Neovascularization Pathologic	Associate	38087190
Noonan like syndrome	Associate	34716204
Optic Nerve Hypoplasia	Associate	37762002
Ovarian Neoplasms	Associate	20826764, 21435433, 27272709, 27791010, 28888422, 32650224, 36311816
Polycystic Ovary Syndrome	Associate	28004769
Pontocerebellar Hypoplasia	Associate	37762002
Porphyria Cutanea Tarda	Associate	34476575
Prostatic Neoplasms	Associate	23493267, 23598299

PPP2R1A (protein phosphatase 2 scaffold subunit Aalpha)