Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55157
Gene name	Aspartyl-tRNA synthetase 2, mitochondrial
Gene symbol	DARS2
Synonyms (NCBI Gene)	ASPRSLBSLMT-ASPRSmtAspRS
Chromosome	1
Chromosome location	1q25.1
Summary	The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal

Show/Hide all (30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114714497	G>A,T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs121918205	C>G	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs121918206	C>T	Pathogenic	Stop gained, coding sequence variant
rs121918207	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs121918208	G>T	Pathogenic	Missense variant, coding sequence variant
rs121918209	A>G	Pathogenic	Missense variant, coding sequence variant
rs121918210	G>A	Pathogenic	Missense variant, coding sequence variant
rs121918211	G>A,C,T	Pathogenic	Stop gained, missense variant, intron variant, coding sequence variant
rs121918212	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs121918213	T>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs142433332	T>A,C,G	Pathogenic	Splice donor variant
rs182811621	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs200670286	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs754752982	C>A,G	Likely-pathogenic	Intron variant
rs759123043	T>C,G	Pathogenic	Splice donor variant
rs773706813	AT>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs869312930	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs972404343	C>A,G	Likely-pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs1057524364	T>G	Likely-pathogenic	Genic downstream transcript variant, stop gained, coding sequence variant
rs1064793097	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1064794825	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1085307776	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1085307970	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1209550754	G>A	Likely-pathogenic, not-provided	Coding sequence variant, missense variant
rs1553201258	TT>C	Pathogenic	Intron variant
rs1553202681	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1553204327	GG>C	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs1557852998	C>T	Pathogenic	Stop gained, coding sequence variant
rs1557853625	T>A	Pathogenic	Intron variant
rs1571995707	T>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant

257

Show/Hide all (257)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028622	hsa-miR-30a-5p	Proteomics	18668040
MIRT050370	hsa-miR-24-3p	CLASH	23622248
MIRT046656	hsa-miR-222-3p	CLASH	23622248
MIRT045053	hsa-miR-186-5p	CLASH	23622248
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	19536157
MIRT637344	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	19536157
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	19536157
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	19536157
MIRT637337	hsa-miR-5690	HITS-CLIP	19536157
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	19536157
MIRT637335	hsa-miR-4539	HITS-CLIP	19536157
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT663205	hsa-miR-6735-3p	HITS-CLIP	19536157
MIRT663204	hsa-miR-2861	HITS-CLIP	19536157
MIRT637333	hsa-miR-7977	HITS-CLIP	19536157
MIRT688588	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT688587	hsa-miR-4695-5p	HITS-CLIP	23313552
MIRT688586	hsa-miR-4779	HITS-CLIP	23313552
MIRT688585	hsa-miR-3929	HITS-CLIP	23313552
MIRT688584	hsa-miR-4419b	HITS-CLIP	23313552
MIRT688583	hsa-miR-4478	HITS-CLIP	23313552
MIRT688582	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT688581	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT688580	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT688579	hsa-miR-4459	HITS-CLIP	23313552
MIRT688578	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT688577	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT688576	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT688575	hsa-miR-6134	HITS-CLIP	23313552
MIRT688574	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT688573	hsa-miR-4266	HITS-CLIP	23313552
MIRT688572	hsa-miR-1273e	HITS-CLIP	23313552
MIRT663211	hsa-miR-1245a	HITS-CLIP	23824327
MIRT663210	hsa-miR-8079	HITS-CLIP	23824327
MIRT663209	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT663208	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT663207	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT663206	hsa-miR-640	HITS-CLIP	23824327
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT637344	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT637337	hsa-miR-5690	HITS-CLIP	23824327
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT637335	hsa-miR-4539	HITS-CLIP	23824327
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT663205	hsa-miR-6735-3p	HITS-CLIP	23824327
MIRT663204	hsa-miR-2861	HITS-CLIP	23824327
MIRT663203	hsa-miR-4417	HITS-CLIP	23824327
MIRT637333	hsa-miR-7977	HITS-CLIP	23824327
MIRT663202	hsa-miR-4265	HITS-CLIP	23824327
MIRT663201	hsa-miR-4296	HITS-CLIP	23824327
MIRT663200	hsa-miR-4322	HITS-CLIP	23824327
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT637344	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT637337	hsa-miR-5690	HITS-CLIP	23824327
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT637335	hsa-miR-4539	HITS-CLIP	23824327
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT637333	hsa-miR-7977	HITS-CLIP	23824327
MIRT608618	hsa-miR-552-3p	HITS-CLIP	24906430
MIRT608617	hsa-miR-8062	HITS-CLIP	24906430
MIRT608616	hsa-miR-455-5p	HITS-CLIP	24906430
MIRT608615	hsa-miR-660-3p	HITS-CLIP	24906430
MIRT608614	hsa-miR-4324	HITS-CLIP	24906430
MIRT608613	hsa-miR-544b	HITS-CLIP	24906430
MIRT608612	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608611	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608610	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608609	hsa-miR-3653-5p	HITS-CLIP	24906430
MIRT608608	hsa-miR-1976	HITS-CLIP	24906430
MIRT608607	hsa-miR-6791-3p	HITS-CLIP	24906430
MIRT608606	hsa-miR-6829-3p	HITS-CLIP	24906430
MIRT608605	hsa-miR-3199	HITS-CLIP	24906430
MIRT608604	hsa-miR-8052	HITS-CLIP	24906430
MIRT608603	hsa-miR-365a-5p	HITS-CLIP	24906430
MIRT608602	hsa-miR-365b-5p	HITS-CLIP	24906430
MIRT608601	hsa-miR-1200	HITS-CLIP	24906430
MIRT608600	hsa-miR-4279	HITS-CLIP	24906430
MIRT608599	hsa-miR-6869-5p	HITS-CLIP	24906430
MIRT516625	hsa-miR-4438	PAR-CLIP	23446348
MIRT516624	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT516623	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516622	hsa-miR-4794	PAR-CLIP	23446348
MIRT516621	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516620	hsa-miR-1254	PAR-CLIP	23446348
MIRT516619	hsa-miR-3116	PAR-CLIP	23446348
MIRT516617	hsa-miR-661	PAR-CLIP	23446348
MIRT516618	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT516616	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT516615	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT516614	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT516613	hsa-miR-5095	PAR-CLIP	23446348
MIRT516612	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT050370	hsa-miR-24-3p	HITS-CLIP	28735896
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	19536157
MIRT637344	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	19536157
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	19536157
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	19536157
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	19536157
MIRT637337	hsa-miR-5690	HITS-CLIP	19536157
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	19536157
MIRT637335	hsa-miR-4539	HITS-CLIP	19536157
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	19536157
MIRT663205	hsa-miR-6735-3p	HITS-CLIP	19536157
MIRT663204	hsa-miR-2861	HITS-CLIP	19536157
MIRT637333	hsa-miR-7977	HITS-CLIP	19536157
MIRT688588	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT688587	hsa-miR-4695-5p	HITS-CLIP	23313552
MIRT688586	hsa-miR-4779	HITS-CLIP	23313552
MIRT688585	hsa-miR-3929	HITS-CLIP	23313552
MIRT688584	hsa-miR-4419b	HITS-CLIP	23313552
MIRT688583	hsa-miR-4478	HITS-CLIP	23313552
MIRT688582	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT688581	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT688580	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT688579	hsa-miR-4459	HITS-CLIP	23313552
MIRT688578	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT688577	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT688576	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT688575	hsa-miR-6134	HITS-CLIP	23313552
MIRT688574	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT688573	hsa-miR-4266	HITS-CLIP	23313552
MIRT688572	hsa-miR-1273e	HITS-CLIP	23313552
MIRT663211	hsa-miR-1245a	HITS-CLIP	23824327
MIRT663210	hsa-miR-8079	HITS-CLIP	23824327
MIRT663209	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT663208	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT663207	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT663206	hsa-miR-640	HITS-CLIP	23824327
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT637344	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT637337	hsa-miR-5690	HITS-CLIP	23824327
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT637335	hsa-miR-4539	HITS-CLIP	23824327
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT663205	hsa-miR-6735-3p	HITS-CLIP	23824327
MIRT663204	hsa-miR-2861	HITS-CLIP	23824327
MIRT663203	hsa-miR-4417	HITS-CLIP	23824327
MIRT637333	hsa-miR-7977	HITS-CLIP	23824327
MIRT663202	hsa-miR-4265	HITS-CLIP	23824327
MIRT663201	hsa-miR-4296	HITS-CLIP	23824327
MIRT663200	hsa-miR-4322	HITS-CLIP	23824327
MIRT637343	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT637344	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT637342	hsa-miR-4714-5p	HITS-CLIP	23824327
MIRT637341	hsa-miR-514a-5p	HITS-CLIP	23824327
MIRT637340	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT637339	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT637338	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT637337	hsa-miR-5690	HITS-CLIP	23824327
MIRT637336	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT637335	hsa-miR-4539	HITS-CLIP	23824327
MIRT637334	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT637333	hsa-miR-7977	HITS-CLIP	23824327
MIRT516625	hsa-miR-4438	PAR-CLIP	23446348
MIRT516624	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT516623	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516622	hsa-miR-4794	PAR-CLIP	23446348
MIRT516621	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516620	hsa-miR-1254	PAR-CLIP	23446348
MIRT516619	hsa-miR-3116	PAR-CLIP	23446348
MIRT516617	hsa-miR-661	PAR-CLIP	23446348
MIRT516618	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT516616	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT516615	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT516614	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT516613	hsa-miR-5095	PAR-CLIP	23446348
MIRT516612	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT923234	hsa-miR-134	CLIP-seq
MIRT923235	hsa-miR-141	CLIP-seq
MIRT923236	hsa-miR-142-5p	CLIP-seq
MIRT923237	hsa-miR-200a	CLIP-seq
MIRT923238	hsa-miR-203	CLIP-seq
MIRT923239	hsa-miR-2110	CLIP-seq
MIRT923240	hsa-miR-3118	CLIP-seq
MIRT923241	hsa-miR-3155	CLIP-seq
MIRT923242	hsa-miR-3155b	CLIP-seq
MIRT923243	hsa-miR-3164	CLIP-seq
MIRT923244	hsa-miR-3185	CLIP-seq
MIRT923245	hsa-miR-320a	CLIP-seq
MIRT923246	hsa-miR-320b	CLIP-seq
MIRT923247	hsa-miR-320c	CLIP-seq
MIRT923248	hsa-miR-320d	CLIP-seq
MIRT923249	hsa-miR-340	CLIP-seq
MIRT923250	hsa-miR-4271	CLIP-seq
MIRT923251	hsa-miR-4276	CLIP-seq
MIRT923252	hsa-miR-4282	CLIP-seq
MIRT923253	hsa-miR-4307	CLIP-seq
MIRT923254	hsa-miR-4429	CLIP-seq
MIRT923255	hsa-miR-4477a	CLIP-seq
MIRT923256	hsa-miR-4522	CLIP-seq
MIRT923257	hsa-miR-4528	CLIP-seq
MIRT923258	hsa-miR-4725-3p	CLIP-seq
MIRT923259	hsa-miR-4775	CLIP-seq
MIRT923260	hsa-miR-484	CLIP-seq
MIRT923261	hsa-miR-494	CLIP-seq
MIRT923262	hsa-miR-544	CLIP-seq
MIRT923263	hsa-miR-563	CLIP-seq
MIRT923264	hsa-miR-583	CLIP-seq
MIRT923265	hsa-miR-587	CLIP-seq
MIRT923266	hsa-miR-616	CLIP-seq
MIRT923267	hsa-miR-758	CLIP-seq
MIRT2209114	hsa-let-7a	CLIP-seq
MIRT2209115	hsa-let-7b	CLIP-seq
MIRT2209116	hsa-let-7c	CLIP-seq
MIRT2209117	hsa-let-7d	CLIP-seq
MIRT2209118	hsa-let-7e	CLIP-seq
MIRT2209119	hsa-let-7f	CLIP-seq
MIRT2209120	hsa-let-7g	CLIP-seq
MIRT2209121	hsa-let-7i	CLIP-seq
MIRT2209122	hsa-miR-1294	CLIP-seq
MIRT2209123	hsa-miR-202	CLIP-seq
MIRT2209124	hsa-miR-380	CLIP-seq
MIRT2209125	hsa-miR-3924	CLIP-seq
MIRT2209126	hsa-miR-3940-3p	CLIP-seq
MIRT2209127	hsa-miR-3941	CLIP-seq
MIRT2209128	hsa-miR-4458	CLIP-seq
MIRT2209129	hsa-miR-4495	CLIP-seq
MIRT2209130	hsa-miR-4500	CLIP-seq
MIRT2209131	hsa-miR-4643	CLIP-seq
MIRT2209132	hsa-miR-466	CLIP-seq
MIRT2209133	hsa-miR-4672	CLIP-seq
MIRT2209134	hsa-miR-4676-5p	CLIP-seq
MIRT2209135	hsa-miR-4685-5p	CLIP-seq
MIRT2209136	hsa-miR-4688	CLIP-seq
MIRT2209137	hsa-miR-4710	CLIP-seq
MIRT2209138	hsa-miR-4783-3p	CLIP-seq
MIRT2209139	hsa-miR-4789-3p	CLIP-seq
MIRT2209140	hsa-miR-4795-3p	CLIP-seq
MIRT2209141	hsa-miR-550b	CLIP-seq
MIRT2209142	hsa-miR-575	CLIP-seq
MIRT2209143	hsa-miR-656	CLIP-seq
MIRT2209144	hsa-miR-98	CLIP-seq
MIRT2448036	hsa-miR-1185	CLIP-seq
MIRT2448037	hsa-miR-1272	CLIP-seq
MIRT2448038	hsa-miR-3605-5p	CLIP-seq
MIRT2448039	hsa-miR-3679-5p	CLIP-seq
MIRT2448040	hsa-miR-4753-3p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	TAS	15779907
GO:0000166	Function	Nucleotide binding	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004812	Function	Aminoacyl-tRNA ligase activity	IEA
GO:0004815	Function	Aspartate-tRNA ligase activity	IBA
GO:0004815	Function	Aspartate-tRNA ligase activity	IDA	23275545
GO:0004815	Function	Aspartate-tRNA ligase activity	IEA
GO:0005515	Function	Protein binding	IPI	15779907, 28514442, 29568061, 30021884, 32296183, 33961781, 35156780, 36012204
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	15779907
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	15779907
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	IMP	30006346
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006412	Process	Translation	IEA
GO:0006418	Process	TRNA aminoacylation for protein translation	IEA
GO:0006422	Process	Aspartyl-tRNA aminoacylation	IBA
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IMP	30006346
GO:0042803	Function	Protein homodimerization activity	IPI	15779907, 23275545
GO:0043039	Process	TRNA aminoacylation	IDA	15779907, 17384640
GO:0050560	Function	Aspartate-tRNA(Asn) ligase activity	IDA	15779907, 17384640
GO:0070145	Process	Mitochondrial asparaginyl-tRNA aminoacylation	IC	15779907
GO:0070145	Process	Mitochondrial asparaginyl-tRNA aminoacylation	IDA	23275545

MIM	HGNC	e!Ensembl
610956	25538	ENSG00000117593

Q6PI48

Protein name

Aspartate--tRNA ligase, mitochondrial (EC 6.1.1.12) (Aspartyl-tRNA synthetase) (AspRS)

Protein function

Catalyzes the attachment of aspartate to tRNA(Asp) in a two-step reaction: aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp).

PDB

4AH6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01336	tRNA_anti-codon	66 → 149	OB-fold nucleic acid binding domain	Domain
PF00152	tRNA-synt_2	166 → 608	tRNA synthetases class II (D, K and N)	Domain
PF02938	GAD	356 → 452	GAD domain	Domain

Sequence

MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSS
HLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSG
TVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRS
FQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLP
QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGL
LQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDAL
SKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLW
VVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGS
IRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRD
VIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Sequence length

645

Interactions

View interactions

	KEGG		Reactome
	Aminoacyl-tRNA biosynthesis		Mitochondrial tRNA aminoacylation

253

Show/Hide Causal Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
DARS2-related disorder	Pathogenic	rs121918208	RCV003934791
Dysmetria	Pathogenic	rs1553201258, rs142433332	RCV000415026 RCV000415333
Gait ataxia	Pathogenic	rs1553201258, rs142433332	RCV000415026 RCV000415333
Gait imbalance	Pathogenic	rs1553201258, rs142433332	RCV000415026 RCV000415333
Leukoencephalopathy with brain stem and spinal cord involvement-high lactate syndrome	Likely pathogenic; Pathogenic	rs778731200, rs772489337, rs200392167, rs751929342, rs2102639360, rs1281179187, rs267598175, rs770447116, rs2102641279, rs1334706550, rs1553201258, rs121918206, rs121918207, rs121918208, rs142433332 View all (24 more)	RCV002246416 RCV001548761 RCV005253862 RCV001663401 RCV001838824 RCV005253882 RCV001780608 RCV005253888 RCV005253916 RCV005253975 RCV000001112 RCV000001114 RCV000001115 RCV000001116 RCV000001117 RCV000001118 RCV000001119 RCV002281618 RCV005254056 RCV003341525 RCV005254115 RCV005254659 RCV003317926 RCV005254767 RCV005254812 RCV003486509 RCV005871278 RCV003988184 RCV004587963 RCV005252894 RCV000023847 RCV005252920 RCV001662476 RCV005252987 RCV005252990 RCV000626171 RCV005253104 RCV000986465 RCV001095703
Ovarian serous cystadenocarcinoma	Pathogenic	rs142433332	RCV005887151
See cases	Pathogenic; Likely pathogenic	rs121918208, rs771905691	RCV002254674 RCV002252316
Spastic ataxia	Pathogenic	rs2102636056	RCV001647159

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs9425753, rs115051769	RCV005890699 RCV005890710
Cervical cancer	Benign; Likely benign	rs9425753, rs115051769, rs746151025	RCV005890701 RCV005890712 RCV005870783
Cholangiocarcinoma	Benign	rs9425753	RCV005890708
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	rs200078808	RCV005891525
Clear cell carcinoma of kidney	Benign; Conflicting classifications of pathogenicity	rs9425753, rs115051769, rs769597479	RCV005890702 RCV005890714 RCV005900824
Colon adenocarcinoma	Likely benign	rs563212168	RCV005869500
Familial cancer of breast	Benign; Likely benign; Conflicting classifications of pathogenicity; -	rs374122386, rs200078808, rs769597479, rs563212168, rs746151025, rs2295366, rs267598175, rs201817953	RCV005869667 RCV005891523 RCV005900822 RCV005869499 RCV005870781 RCV005904264 RCV005983323 RCV005913672
Familial pancreatic carcinoma	Benign	rs115051769	RCV005890716
Gastric cancer	Benign	rs9425753, rs115051769	RCV005890704 RCV005890718
Hepatocellular carcinoma	Benign	rs2295366	RCV005904265
Lung cancer	Benign	rs6425260, rs9425753	RCV005919820 RCV005890709
Lymphoma	Benign	rs115051769	RCV005890719
Malignant lymphoma, large B-cell, diffuse	Benign	rs2295366	RCV005904266
Malignant tumor of esophagus	Benign	rs9425753, rs115051769	RCV005890700 RCV005890711
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	rs769597479	RCV005900823
Mitochondrial disease	Conflicting classifications of pathogenicity	rs1279409996, rs375700548	RCV005361534 RCV005361657
Nonpapillary renal cell carcinoma	Likely benign; -	rs746151025, rs267598175	RCV005870782 RCV005983324
Ovarian cancer	Benign	rs115051769	RCV005890713
Pancreatic adenocarcinoma	Conflicting classifications of pathogenicity	rs769597479	RCV005900825
Sarcoma	Benign	rs9425753, rs115051769	RCV005890703 RCV005890717
Thymoma	Benign; Conflicting classifications of pathogenicity	rs9425753, rs115051769, rs769597479, rs549430098	RCV005890707 RCV005890722 RCV005900826 RCV005913671
Thyroid cancer, nonmedullary, 1	-	rs267598175	RCV005983325
Uterine carcinosarcoma	Benign	rs6425260, rs9425753, rs115051769	RCV005919819 RCV005890706 RCV005890721
Uterine corpus endometrial carcinoma	Benign; Likely benign; Conflicting classifications of pathogenicity	rs115051769, rs200078808, rs746151025, rs201817953	RCV005890723 RCV005891524 RCV005870784 RCV005913673
Uveal melanoma	Benign	rs115051769	RCV005890715

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34996932, 36085578, 37626419
Ataxia	Associate	24030952
Brain Stem Neoplasms	Associate	35914483
Carcinogenesis	Associate	29052520
Carcinoma Hepatocellular	Associate	29052520
Cerebellar Diseases	Associate	35914483
Charcot Marie Tooth Disease	Associate	38549004
Developmental Disabilities	Associate	30006346
Leukodystrophy Metachromatic	Associate	35803560
Leukoencephalopathies	Associate	23643384, 30006346, 30352563, 35803560, 40185339
Leukoencephalopathy with Brainstem and Spinal Cord Involvement and Lactate Elevation	Associate	23643384, 30352563, 30635318, 31671122, 35914483, 37563224, 40185339
Mitochondrial Diseases	Associate	30283131, 40185339
Neoplasms	Associate	36085578, 37626419
Neurodegenerative Diseases	Associate	30006346
Posterior column ataxia	Associate	35914483
Spinal Cord Diseases	Associate	23643384, 30352563
Spinal Diseases	Associate	30635318
Spinocerebellar Degenerations	Associate	24030952
Urinary Bladder Neoplasms	Associate	33685397

DARS2 (aspartyl-tRNA synthetase 2, mitochondrial)