ZDHHC4 (zDHHC palmitoyltransferase 4)

Gene

• Entrez ID: 55146
• Gene name: ZDHHC palmitoyltransferase 4
• Gene symbol: ZDHHC4
• Synonyms (NCBI Gene): ZNF374
• Chromosome: 7
• Chromosome location: 7p22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT026977	hsa-miR-107	Microarray	20489155
MIRT036465	hsa-miR-1226-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	16125763, 31390091
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	21926431
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	16647879
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IDA	30605677, 35606353
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	35609316, 38020884
GO:0030336	Process	Negative regulation of cell migration	IDA	27494834
GO:0045089	Process	Positive regulation of innate immune response	IDA	35606353
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	ISS
GO:0072659	Process	Protein localization to plasma membrane	IDA	37461827
GO:0072659	Process	Protein localization to plasma membrane	IDA	30605677

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9NPG8
• Protein name: Palmitoyltransferase ZDHHC4 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 4) (DHHC-4) (Zinc finger protein 374)
• Protein function: Palmitoyltransferase that catalyzes the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2, GSK3B or MAVS. Mediates GSK3B palmitoylation to prevent its AKT1-mediated phosphorylation leading to activation of t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01529	DHHC	144 → 294	DHHC palmitoyltransferase	Family

• Sequence:

  MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYL
  FHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCG
  TNPGIITKANELLFLHVYEFDEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCV
  WVNNCIGAWNIRYFLIYVLTLTASAATVAIVSTTFLVHLVVMSDLYQETYIDDLGHLHVM
  DTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTTNEWYRGDWAWCQR
  CPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE

• Sequence length: 344

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Bone Diseases	Stimulate	20362080	★☆☆☆☆ Found in Text Mining only