Gene Gene information from NCBI Gene database.
Entrez ID 55139
Gene name Ankyrin repeat and zinc finger peptidyl tRNA hydrolase 1
Gene symbol ANKZF1
Synonyms (NCBI Gene)
Vms1ZNF744
Chromosome 2
Chromosome location 2q35
miRNA miRNA information provided by mirtarbase database.
11
miRTarBase ID miRNA Experiments Reference
MIRT018525 hsa-miR-335-5p Microarray 18185580
MIRT032393 hsa-let-7b-5p Proteomics 18668040
MIRT045168 hsa-miR-186-5p CLASH 23622248
MIRT2172132 hsa-miR-101 CLIP-seq
MIRT2172133 hsa-miR-3180-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0001680 Process TRNA 3'-terminal CCA addition IDA 32075755
GO:0004518 Function Nuclease activity IEA
GO:0004519 Function Endonuclease activity IEA
GO:0004521 Function RNA endonuclease activity IDA 30244831, 31011209
GO:0005515 Function Protein binding IPI 22190034
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617541 25527 ENSG00000163516
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8Y5
Protein name tRNA endonuclease ANKZF1 (EC 3.1.-.-) (Ankyrin repeat and zinc finger domain-containing protein 1) (Zinc finger protein 744)
Protein function Endonuclease that cleaves polypeptidyl-tRNAs downstream of the ribosome-associated quality control (RQC) pathway to release incompletely synthesized polypeptides for degradation (PubMed:29632312, PubMed:30244831, PubMed:31011209). The RQC pathwa
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18826 bVLRF1 207 351 Bacteroidetes VLRF1 release factor Domain
PF00023 Ank 534 566 Ankyrin repeat Repeat
PF18716 VATC 683 725 Vms1-associating treble clef domain Domain
Sequence
MSPAPDAAPAPASISLFDLSADAPVFQGLSLVSHAPGEALARAPRTSCSGSGERESPERK
LLQGPMDISEKLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSS
TGDLSSISGSEDSDSASEEDLQTLDRERATFEKLSRPPGFYPHRVLFQNAQGQFLYAYRC
VLGPHQDPPEEAELLLQNLQSRGPRDCVVLMAAAGHFAGAIFQGREVVTHKTFHRYTVRA
KRGTAQGLRDARGGPSHSAGANLRRYNEATLYKDVRDLLAGPSWAKALEEAGTILLRAPR
SGRSLFFGGKGAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYEE
DPREAVRLH
SPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVEL
TVGTLDLCESEVLPKRRRRKRNKKEKSRDQEAGAHRTLLQQTQEEEPSTQSSQAVAAPLG
PLLDEAKAPGQPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLH
AAAAAGRGSVVRLLLEAGADPTVQDS
RARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKA
QVPGPLTPEMEARQATRKREQKAARRQREEQQQRQQEQEEREREEQRRFAALSDREKRAL
AAERRLAAQLGAPTSPIPDSAIVNTRRCWSCGASLQGLTPFHYLDFSFCSTRCLQDHRRQ
AGRPS
S
Sequence length 726
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
14
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKZF1-related disorder Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 35109912
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 35123420
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 33287763, 33836688, 34596153
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Associate 32744303, 35109912
★☆☆☆☆
Found in Text Mining only
Hypoxia Associate 34596153
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Associate 28302725
★★☆☆☆
Found in Text Mining + Unknown/Other Associations