CRTAC1 (cartilage acidic protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55118
Gene name Gene Name - the full gene name approved by the HGNC.
Cartilage acidic protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRTAC1
Synonyms (NCBI Gene) Gene synonyms aliases
ASPIC, ASPIC1, CEP-68, CEP68, LOTUS
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in cultur
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(24)
miRTarBase ID miRNA Experiments Reference
MIRT910550 hsa-miR-1182 CLIP-seq
MIRT910551 hsa-miR-1193 CLIP-seq
MIRT910552 hsa-miR-1197 CLIP-seq
MIRT910553 hsa-miR-2110 CLIP-seq
MIRT910554 hsa-miR-3117-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
GO:0007413 Process Axonal fasciculation IBA
GO:0007413 Process Axonal fasciculation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606276 14882 ENSG00000095713
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9NQ79
Protein name Cartilage acidic protein 1 (68 kDa chondrocyte-expressed protein) (CEP-68) (ASPIC)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13517 VCBS 62 → 132 Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella Repeat
PF13517 VCBS 253 → 310 Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella Repeat
PF13517 VCBS 299 → 363 Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella Repeat
PF07593 UnbV_ASPIC 458 → 521 ASPIC and UnbV Family
PF07645 EGF_CA 559 → 605 Calcium-binding EGF domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the interterritorial matrix of articular deep zone cartilage (at protein level). Isoform 1 and isoform 2 are expressed in brain. Isoform 1 is detected in lung and chondrocytes. Detected in cartilage, bone, cultured chondro
Sequence 
MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAV
TDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTAC
DIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSV
ACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGG
RGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADF
NRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELE
IFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL
ILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGG
SGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDP
APLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNE
DGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPS
C
Sequence length 661
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Severe insulin-resistant type 2 diabetes N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Show/Hide Text Mining Associations (22)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 39791348
Amyotrophic Lateral Sclerosis Associate 32792518
Aneurysm Associate 29929532
COVID 19 Inhibit 37667413
Frontotemporal Dementia Associate 32792518
Glomus Tumor Associate 19738042
Hip Injuries Associate 33982893
Idiopathic Pulmonary Fibrosis Associate 39289672
Inflammation Associate 27855397
Joint Diseases Associate 33982893