Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55105
Gene name	G-patch domain containing 2
Gene symbol	GPATCH2
Synonyms (NCBI Gene)	CT110GPATC2PPP1R30Pfa1
Chromosome	1
Chromosome location	1q41
Summary	The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [pro

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020254	hsa-miR-130b-3p	Sequencing	20371350
MIRT028123	hsa-miR-93-5p	Sequencing	20371350
MIRT029984	hsa-miR-26b-5p	Microarray	19088304
MIRT1028228	hsa-miR-106a	CLIP-seq
MIRT1028229	hsa-miR-106b	CLIP-seq
MIRT1028230	hsa-miR-1207-5p	CLIP-seq
MIRT1028231	hsa-miR-1286	CLIP-seq
MIRT1028232	hsa-miR-17	CLIP-seq
MIRT1028233	hsa-miR-183	CLIP-seq
MIRT1028234	hsa-miR-20a	CLIP-seq
MIRT1028235	hsa-miR-20b	CLIP-seq
MIRT1028236	hsa-miR-219-2-3p	CLIP-seq
MIRT1028237	hsa-miR-2467-3p	CLIP-seq
MIRT1028238	hsa-miR-2964a-3p	CLIP-seq
MIRT1028239	hsa-miR-29a	CLIP-seq
MIRT1028240	hsa-miR-29b	CLIP-seq
MIRT1028241	hsa-miR-29c	CLIP-seq
MIRT1028242	hsa-miR-3169	CLIP-seq
MIRT1028243	hsa-miR-3609	CLIP-seq
MIRT1028244	hsa-miR-3647-3p	CLIP-seq
MIRT1028245	hsa-miR-3672	CLIP-seq
MIRT1028246	hsa-miR-3678-3p	CLIP-seq
MIRT1028247	hsa-miR-377	CLIP-seq
MIRT1028248	hsa-miR-4257	CLIP-seq
MIRT1028249	hsa-miR-4517	CLIP-seq
MIRT1028250	hsa-miR-4521	CLIP-seq
MIRT1028251	hsa-miR-4643	CLIP-seq
MIRT1028252	hsa-miR-4724-5p	CLIP-seq
MIRT1028253	hsa-miR-4736	CLIP-seq
MIRT1028254	hsa-miR-4763-3p	CLIP-seq
MIRT1028255	hsa-miR-4768-5p	CLIP-seq
MIRT1028256	hsa-miR-4786-3p	CLIP-seq
MIRT1028257	hsa-miR-4796-3p	CLIP-seq
MIRT1028258	hsa-miR-505	CLIP-seq
MIRT1028259	hsa-miR-514	CLIP-seq
MIRT1028260	hsa-miR-514b-3p	CLIP-seq
MIRT1028261	hsa-miR-519a	CLIP-seq
MIRT1028262	hsa-miR-519b-3p	CLIP-seq
MIRT1028263	hsa-miR-519c-3p	CLIP-seq
MIRT1028264	hsa-miR-519d	CLIP-seq
MIRT1028265	hsa-miR-548ah	CLIP-seq
MIRT1028266	hsa-miR-579	CLIP-seq
MIRT1028267	hsa-miR-605	CLIP-seq
MIRT1028268	hsa-miR-642b	CLIP-seq
MIRT1028269	hsa-miR-767-5p	CLIP-seq
MIRT1028270	hsa-miR-875-3p	CLIP-seq
MIRT1028271	hsa-miR-93	CLIP-seq
MIRT2005001	hsa-miR-3074-5p	CLIP-seq
MIRT2005002	hsa-miR-4421	CLIP-seq
MIRT2005003	hsa-miR-4456	CLIP-seq
MIRT2005004	hsa-miR-4738-3p	CLIP-seq
MIRT2005005	hsa-miR-4796-5p	CLIP-seq
MIRT2005006	hsa-miR-582-3p	CLIP-seq
MIRT1028267	hsa-miR-605	CLIP-seq
MIRT1028230	hsa-miR-1207-5p	CLIP-seq
MIRT1028231	hsa-miR-1286	CLIP-seq
MIRT2237711	hsa-miR-1323	CLIP-seq
MIRT1028233	hsa-miR-183	CLIP-seq
MIRT1028242	hsa-miR-3169	CLIP-seq
MIRT2237712	hsa-miR-338-5p	CLIP-seq
MIRT1028245	hsa-miR-3672	CLIP-seq
MIRT2237713	hsa-miR-4261	CLIP-seq
MIRT1028253	hsa-miR-4736	CLIP-seq
MIRT1028254	hsa-miR-4763-3p	CLIP-seq
MIRT2237714	hsa-miR-4765	CLIP-seq
MIRT1028255	hsa-miR-4768-5p	CLIP-seq
MIRT2237715	hsa-miR-494	CLIP-seq
MIRT2237716	hsa-miR-548o	CLIP-seq
MIRT1028267	hsa-miR-605	CLIP-seq
MIRT2005003	hsa-miR-4456	CLIP-seq
MIRT2005004	hsa-miR-4738-3p	CLIP-seq
MIRT2450531	hsa-miR-541	CLIP-seq
MIRT2005006	hsa-miR-582-3p	CLIP-seq
MIRT2450532	hsa-miR-654-5p	CLIP-seq
MIRT1028228	hsa-miR-106a	CLIP-seq
MIRT1028229	hsa-miR-106b	CLIP-seq
MIRT1028232	hsa-miR-17	CLIP-seq
MIRT1028234	hsa-miR-20a	CLIP-seq
MIRT1028235	hsa-miR-20b	CLIP-seq
MIRT1028237	hsa-miR-2467-3p	CLIP-seq
MIRT1028243	hsa-miR-3609	CLIP-seq
MIRT1028246	hsa-miR-3678-3p	CLIP-seq
MIRT1028248	hsa-miR-4257	CLIP-seq
MIRT1028257	hsa-miR-4796-3p	CLIP-seq
MIRT1028261	hsa-miR-519a	CLIP-seq
MIRT1028262	hsa-miR-519b-3p	CLIP-seq
MIRT1028263	hsa-miR-519c-3p	CLIP-seq
MIRT1028264	hsa-miR-519d	CLIP-seq
MIRT1028265	hsa-miR-548ah	CLIP-seq
MIRT1028266	hsa-miR-579	CLIP-seq
MIRT1028271	hsa-miR-93	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA

MIM	HGNC	e!Ensembl
616836	25499	ENSG00000092978

Q9NW75

Protein name

G patch domain-containing protein 2

Protein function

Enhances the ATPase activity of DHX15 in vitro.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01585	G-patch	467 → 511	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:19432882}.

Sequence

MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCP
LKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQ
MLVAKRRPSSNLNNNVRGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRT
MTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQGPKIQDEGVVLESEETNQTNK
DKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITG
VVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSG
GTPTSMVPIPGPVGNKRMVHFSPDSHHHDHWFSPGARTEHDQHQLLRDNRAERGHKKNCS
VRTASRQTSMHLGSLCTGDIKRRRKAAPLPGPTTAGFVGENAQPILENNIGNRMLQNMGW
TPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSATTTPNAGKSA

Sequence length

528

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	19432882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19432882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19432882	★★★★★ ★☆☆☆☆ Found in Text Mining only

GPATCH2 (G-patch domain containing 2)