Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55105
Gene name Gene Name - the full gene name approved by the HGNC.
G-patch domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPATCH2
Synonyms (NCBI Gene) Gene synonyms aliases
CT110, GPATC2, PPP1R30, Pfa1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q41
Summary Summary of gene provided in NCBI Entrez Gene.
The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [pro
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020254 hsa-miR-130b-3p Sequencing 20371350
MIRT028123 hsa-miR-93-5p Sequencing 20371350
MIRT029984 hsa-miR-26b-5p Microarray 19088304
MIRT1028228 hsa-miR-106a CLIP-seq
MIRT1028229 hsa-miR-106b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616836 25499 ENSG00000092978
Protein
UniProt ID Q9NW75
Protein name G patch domain-containing protein 2
Protein function Enhances the ATPase activity of DHX15 in vitro.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01585 G-patch 467 511 G-patch domain Family
Tissue specificity TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:19432882}.
Sequence
MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCP
LKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQ
MLVAKRRPSSNLNNNVRGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRT
MTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQGPKIQDEGVVLESEETNQTNK
DKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITG
VVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSG
GTPTSMVPIPGPVGNKRMVHFSPDSHHHDHWFSPGARTEHDQHQLLRDNRAERGHKKNCS
VRTASRQTSMHLGSLCTGDIKRRRKAAPLPGPTTAGFVGENAQPILENNIGNRMLQNMGW
TPGSGLGRDGKGISEPIQAMQRPKGLGLGFP
LPKSTSATTTPNAGKSA
Sequence length 528
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 19432882
Hereditary Breast and Ovarian Cancer Syndrome Associate 19432882
Neoplasms Associate 19432882