WDR70 (WD repeat domain 70)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55100
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 70
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR70
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(27)
miRTarBase ID miRNA Experiments Reference
MIRT649460 hsa-miR-5193 HITS-CLIP 23824327
MIRT649459 hsa-miR-660-3p HITS-CLIP 23824327
MIRT649458 hsa-miR-7110-3p HITS-CLIP 23824327
MIRT649457 hsa-miR-6817-3p HITS-CLIP 23824327
MIRT649456 hsa-miR-6515-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm TAS
GO:0019899 Function Enzyme binding IPI 23382074
GO:0035861 Component Site of double-strand break IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617233 25495 ENSG00000082068
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9NW82
Protein name WD repeat-containing protein 70
PDB 6ZYM , 7A5P , 8I0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 168 → 210 WD domain, G-beta repeat Repeat
PF00400 WD40 323 → 360 WD domain, G-beta repeat Repeat
PF00400 WD40 365 → 406 WD domain, G-beta repeat Repeat
Sequence 
MERSGPSEVTGSDASGPDPQLAVTMGFTGFGKKARTFDLEAMFEQTRRTAVERSRKTLEA
REKEEEMNREKELRRQNEDIEPTSSRSNVVRDCSKSSSRDTSSSESEQSSDSSDDELIGP
PLPPKMVGKPVNFMEEDILGPLPPPLNEEEEEAEEEEEEEEEEENPVHKIPDSHEITLKH
GTKTVSALGLDPSGARLVTGGYDYDVKFWDFAGMDASFKAFRSLQPCECHQIKSLQYSNT
GDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTKGHTAMLHTGSWHPKIKGEFM
TCSNDATVRTWEVENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAACQNGSIQIWD
RNLTVHPKFHYKQAHDSGTDTSCVTFSYDGNVLASRGGDDSLKLWDIRQFNKPLFSASGL
PTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWH
PKLNQIMVGTGNGLAKVYYDPNKSQRGAKLCVVKTQRKAKQAETLTQDYIITPHALPMFR
EPRQRSTRKQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTDDS
NPREAILRHAKAAEDSPYWVSPAYSKTQPKTMFAQVESDDEEAKNEPEWKKRKI
Sequence length 654
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Metabolic Syndrome Serum omega-3 polyunsaturated fatty acid concentration in metabolic syndrome, Serum docosahexaenoic fatty acid concentration in metabolic syndrome N/A N/A GWAS