Gene Gene information from NCBI Gene database.
Entrez ID 5507
Gene name Protein phosphatase 1 regulatory subunit 3C
Gene symbol PPP1R3C
Synonyms (NCBI Gene)
PPP1R5PTG
Chromosome 10
Chromosome location 10q23.32
Summary This gene encodes a carbohydrate binding protein that is a subunit of the protein phosphatase 1 (PP1) complex. PP1 catalyzes reversible protein phosphorylation, which is important in a wide range of cellular activities. The encoded protein affects glycoge
miRNA miRNA information provided by mirtarbase database.
284
miRTarBase ID miRNA Experiments Reference
MIRT017350 hsa-miR-335-5p Microarray 18185580
MIRT1256724 hsa-miR-101 CLIP-seq
MIRT1256725 hsa-miR-1243 CLIP-seq
MIRT1256726 hsa-miR-1246 CLIP-seq
MIRT1256727 hsa-miR-1252 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
HIF1A Unknown 20888814
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000164 Component Protein phosphatase type 1 complex IBA
GO:0004722 Function Protein serine/threonine phosphatase activity TAS 8985175
GO:0005515 Function Protein binding IPI 14532330, 18070875, 22321011, 25416956, 28330616, 28514442, 32296183, 33961781
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602999 9293 ENSG00000119938
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UQK1
Protein name Protein phosphatase 1 regulatory subunit 3C (Protein phosphatase 1 regulatory subunit 5) (PP1 subunit R5) (Protein targeting to glycogen) (PTG)
Protein function Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis u
PDB 7QF7 , 7QFA , 7QFB , 7QM2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03370 CBM_21 151 257 Carbohydrate/starch-binding module (family 21) Domain
Sequence
MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKS
CLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLN
DISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSF
EKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA
NGQVFWDNNDGQNYRIV
HVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL
FPEWQSWGRMENLASYR
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Insulin signaling pathway
Insulin resistance
  Glycogen synthesis
Myoclonic epilepsy of Lafora
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Amaurosis Fugax Associate 18796459
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 26182369
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Associate 18796459
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 24861485
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Associate 10998419
★☆☆☆☆
Found in Text Mining only
Diabetic Nephropathies Associate 37986381
★☆☆☆☆
Found in Text Mining only
Drug Related Side Effects and Adverse Reactions Stimulate 26182369
★☆☆☆☆
Found in Text Mining only
Dysplastic Nevus Syndrome Associate 24999589
★☆☆☆☆
Found in Text Mining only
Embolism Associate 18796459
★☆☆☆☆
Found in Text Mining only
Epilepsy Associate 36261419
★☆☆☆☆
Found in Text Mining only