Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55068
Gene name Gene Name - the full gene name approved by the HGNC.
Ecto-NOX disulfide-thiol exchanger 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ENOX1
Synonyms (NCBI Gene) Gene synonyms aliases
CNOX, PIG38, bA64J21.1, cCNOX
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicit
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030280 hsa-miR-26b-5p Microarray 19088304
MIRT450466 hsa-miR-5692a PAR-CLIP 22100165
MIRT450465 hsa-miR-5692b PAR-CLIP 22100165
MIRT450464 hsa-miR-5692c PAR-CLIP 22100165
MIRT450463 hsa-miR-526b-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003756 Function Protein disulfide isomerase activity IBA
GO:0003756 Function Protein disulfide isomerase activity IDA 19055324
GO:0003954 Function NADH dehydrogenase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610914 25474 ENSG00000120658
Protein
UniProt ID Q8TC92
Protein name Ecto-NOX disulfide-thiol exchanger 1 (Candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase) (cCNOX) (Cell proliferation-inducing gene 38 protein) (Constitutive Ecto-NOX) (cNOX) [Includes: Hydroquinone [NADH] oxidase (EC 1.-.-
Protein function Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 144 204 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lymphocyte cells, breast and breast cancer (at protein level). Found in the sera of cancer patients with a wide variety of cancers including breast, prostate, lung and ovarian cancers, leukemias, and lymphomas. Found also
Sequence
MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPV
GLPGQQLVSDSICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSC
TLFPQNPNLPPPSTRERPPGCKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCH
IRFAEEFMVDKAIYLSGYRMRLGS
STDKKDSGRLHVDFAQARDDFYEWECKQRMRAREER
HRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFSEAITVLLSWIERGEVNRRSA
NQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIVAVFNASTRQK
AWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGM
QQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEIN
VLTVALVNQDRENNIEKRSQGLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSK
ISANEIEMLLMRLPRMFKQEFTGVGATLEKRWKLCAFEGIKTT
Sequence length 643
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Restless Legs Syndrome Restless legs syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 32712615
Anxiety Associate 35301427
Arthritis Rheumatoid Associate 23460240
Atherosclerosis Associate 32712615
Bipolar Disorder Associate 36012217
Coronary Disease Associate 32712615
Depressive Disorder Associate 36012217
Inflammation Associate 32712615
Kidney Diseases Associate 24157943
Kidney Failure Chronic Associate 24157943