Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55048
Gene name Gene Name - the full gene name approved by the HGNC.
VPS37C subunit of ESCRT-I
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VPS37C
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004898 hsa-miR-124-3p Microarray 15685193
MIRT004898 hsa-miR-124-3p Microarray 18668037
MIRT037445 hsa-miR-744-5p CLASH 23622248
MIRT459703 hsa-miR-6771-3p PAR-CLIP 23592263
MIRT459702 hsa-miR-6805-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000813 Component ESCRT I complex IBA 21873635
GO:0000813 Component ESCRT I complex IDA 18005716, 22405001
GO:0000813 Component ESCRT I complex TAS 20588296
GO:0005515 Function Protein binding IPI 17853893, 23924735, 25416956, 31515488, 32296183
GO:0006612 Process Protein targeting to membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610038 26097 ENSG00000167987
Protein
UniProt ID A5D8V6
Protein name Vacuolar protein sorting-associated protein 37C (hVps37C) (ESCRT-I complex subunit VPS37C)
Protein function Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation. {ECO:0000269|PubMed:155095
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07200 Mod_r 5 150 Modifier of rudimentary (Mod(r)) protein Domain
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDRYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRV
EKLQEVVRKPRASQELAGDAPPPRPPPPVR
PVPQGTPPVVEEQPQPPLAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGASGPGYPLRGGRAPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis   Budding and maturation of HIV virion
Membrane binding and targetting of GAG proteins
Endosomal Sorting Complex Required For Transport (ESCRT)
HCMV Late Events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 23143596
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 32831971
Leukemia Myeloid Acute Associate 32783661
pediatric multisystem inflammatory disease COVID 19 related Associate 37255317