BANK1 (B cell scaffold protein with ankyrin repeats 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55024
Gene name Gene Name - the full gene name approved by the HGNC.
B cell scaffold protein with ankyrin repeats 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BANK1
Synonyms (NCBI Gene) Gene synonyms aliases
BANK
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q24
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphos
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(322)
miRTarBase ID miRNA Experiments Reference
MIRT452491 hsa-miR-6768-3p HITS-CLIP 21572407
MIRT452489 hsa-miR-4662a-5p HITS-CLIP 21572407
MIRT452488 hsa-miR-7641 HITS-CLIP 21572407
MIRT452491 hsa-miR-6768-3p HITS-CLIP 23313552
MIRT452490 hsa-miR-590-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005102 Function Signaling receptor binding IPI 11782428
GO:0009617 Process Response to bacterium IEA
GO:0032715 Process Negative regulation of interleukin-6 production IEA
GO:0042113 Process B cell activation IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610292 18233 ENSG00000153064
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8NDB2
Protein name B-cell scaffold protein with ankyrin repeats
Protein function Involved in B-cell receptor (BCR)-induced Ca(2+) mobilization from intracellular stores. Promotes Lyn-mediated phosphorylation of IP3 receptors 1 and 2.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18567 TIR_3 28 → 154 Toll/interleukin-1 receptor domain Domain
PF14545 DBB 199 → 328 Dof, BCAP, and BANK (DBB) motif, Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B-cell but not T-cell or myeloid cell lines. Highest expression in CD19(+) B-cells, with very low expression in other cell populations. {ECO:0000269|PubMed:11782428, ECO:0000269|PubMed:18204447}.
Sequence 
MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLY
RLENFSFRHLELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKS
SDQLYELLNISQSRWEISTEQEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISE
RKEIEELSEASRNTIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTR
PALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLC
QNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCAAKFGLKNLAI
HLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESS
EDQYDDLYVFIPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQME
RSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKK
TGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRAR
IESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLR
QLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFC
CKKDH
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  B cell receptor signaling pathway  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)		 22190364
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Systemic lupus erythematosus Systemic lupus erythematosus rs72556554, rs1575496354, rs1307379746, rs758750492, rs1575497576
Show/Hide Unknown Diseases (10)
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 26974007, 28067908, 23128233, 26192919 ClinVar
Schizophrenia Schizophrenia GWAS
Hypertension Hypertension GWAS
Crohn Disease Crohn Disease GWAS
Show/Hide Text Mining Associations (15)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 19180476, 28925718
Autoimmune Diseases of the Nervous System Associate 30096841
Gastrointestinal Stromal Tumors Associate 31553483
Germinoma Associate 20178649
Graft vs Host Disease Inhibit 27313329
Graft vs Host Disease Associate 27313329
Leukemia Inhibit 33815360
Leukemia Prolymphocytic T Cell Associate 28165464
Lung Diseases Interstitial Associate 27111861
Lupus Erythematosus Systemic Associate 19180476, 19339986, 19357697, 19442287, 20169177, 21792837, 21900951, 21978998, 25882064, 26821283, 27816669, 29070082, 30096841, 32677764