BANK1 (B cell scaffold protein with ankyrin repeats 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 55024
Gene name B cell scaffold protein with ankyrin repeats 1
Gene symbol BANK1
Synonyms (NCBI Gene)
BANK
Chromosome 4
Chromosome location 4q24
Summary The protein encoded by this gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphos
miRNA miRNA information provided by mirtarbase database.
322
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (322)
miRTarBase ID miRNA Experiments Reference
MIRT452491 hsa-miR-6768-3p HITS-CLIP 21572407
MIRT452489 hsa-miR-4662a-5p HITS-CLIP 21572407
MIRT452488 hsa-miR-7641 HITS-CLIP 21572407
MIRT452491 hsa-miR-6768-3p HITS-CLIP 23313552
MIRT452490 hsa-miR-590-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (27)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0002020 Function Protease binding IPI 23555801
GO:0002682 Process Regulation of immune system process IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 11782428, 23555801
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610292 18233 ENSG00000153064
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NDB2
Protein name B-cell scaffold protein with ankyrin repeats
Protein function Involved in B-cell receptor (BCR)-induced Ca(2+) mobilization from intracellular stores. Promotes Lyn-mediated phosphorylation of IP3 receptors 1 and 2.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18567 TIR_3 28 → 154 Toll/interleukin-1 receptor domain Domain
PF14545 DBB 199 → 328 Dof, BCAP, and BANK (DBB) motif, Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B-cell but not T-cell or myeloid cell lines. Highest expression in CD19(+) B-cells, with very low expression in other cell populations. {ECO:0000269|PubMed:11782428, ECO:0000269|PubMed:18204447}.
Sequence 
MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLY
RLENFSFRHLELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKS
SDQLYELLNISQSRWEISTEQEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISE
RKEIEELSEASRNTIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTR
PALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLC
QNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCAAKFGLKNLAI
HLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESS
EDQYDDLYVFIPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQME
RSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKK
TGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRAR
IESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLR
QLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFC
CKKDH
Sequence length 785
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  B cell receptor signaling pathway  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Likely benign rs150616221 RCV005927381
Malignant tumor of esophagus Likely benign rs150616221 RCV005927382
Systemic lupus erythematosus Benign; Likely benign rs35978636 RCV000758191
Variant of unknown significance Uncertain significance rs10516487 RCV003328146
Show/Hide Text Mining Associations (15)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 19180476, 28925718
Autoimmune Diseases of the Nervous System Associate 30096841
Gastrointestinal Stromal Tumors Associate 31553483
Germinoma Associate 20178649
Graft vs Host Disease Inhibit 27313329
Graft vs Host Disease Associate 27313329
Leukemia Inhibit 33815360
Leukemia Prolymphocytic T Cell Associate 28165464
Lung Diseases Interstitial Associate 27111861
Lupus Erythematosus Systemic Associate 19180476, 19339986, 19357697, 19442287, 20169177, 21792837, 21900951, 21978998, 25882064, 26821283, 27816669, 29070082, 30096841, 32677764