Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55012
Gene name Gene Name - the full gene name approved by the HGNC.	Protein phosphatase 2 regulatory subunit B''gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PPP2R3C
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf10, G4-1, G5pr, GDRM, MEGD, SPGF36
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MEGD, SPGF36
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a regulatory subunit of the serine/threonine phosphatase, protein phosphatase 2. This protein is localized to both nuclear and cytoplasmic regions depending on cell cycle phase. Homozygous conditional knockout mice for this gene exhibit

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019852	hsa-miR-375	Microarray	20215506
MIRT1257767	hsa-miR-103a	CLIP-seq
MIRT1257768	hsa-miR-107	CLIP-seq
MIRT1257769	hsa-miR-4484	CLIP-seq
MIRT1257770	hsa-miR-4666-5p	CLIP-seq
MIRT1257771	hsa-miR-548an	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA	21873635
GO:0001782	Process	B cell homeostasis	IBA	21873635
GO:0002759	Process	Regulation of antimicrobial humoral response	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005819	Component	Spindle	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0030865	Process	Cortical cytoskeleton organization	IBA	21873635
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0035303	Process	Regulation of dephosphorylation	IEA
GO:0043029	Process	T cell homeostasis	IBA	21873635
GO:0045579	Process	Positive regulation of B cell differentiation	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048536	Process	Spleen development	IEA
GO:0051900	Process	Regulation of mitochondrial depolarization	IEA

MIM	HGNC	e!Ensembl
615902	17485	ENSG00000092020

Protein

UniProt ID

Q969Q6

Protein name

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma (Protein phosphatase subunit G5PR) (Rhabdomyosarcoma antigen MU-RMS-40.6A/6C)

Protein function

May regulate MCM3AP phosphorylation through phosphatase recruitment (By similarity). May act as a negative regulator of ABCB1 expression and function through the dephosphorylation of ABCB1 by TFPI2/PPP2R3C complex (PubMed:24333728). May play a r

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17958	EF-hand_13	173 → 259	EF-hand domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in brain and other tissues. {ECO:0000269|PubMed:12167160, ECO:0000269|PubMed:15820313}.

Sequence

MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENSADLDDT

Sequence length

453

Interactions

View interactions

	KEGG
	mRNA surveillance pathway Sphingolipid signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Adrenergic signaling in cardiomyocytes T cell receptor signaling pathway Dopaminergic synapse Human papillomavirus infection

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Agenesis of corpus callosum	Agenesis of corpus callosum	rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	26482879
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Rod-cone dystrophy	Rod-Cone Dystrophy	rs267606641, rs199476133, rs193302849, rs777668842, rs775518991, rs752300607, rs142759730, rs756225251, rs536742386, rs1588830568, rs778907433

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	26974007	ClinVar
Gonadal Dysgenesis	gonadal dysgenesis, dysmorphic facies, retinal dystrophy, and myopathy		GenCC
Spermatogenic Failure	spermatogenic failure 36		GenCC

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	33482886
Disorder of Sex Development 46 XY	Associate	37147882

PPP2R3C (protein phosphatase 2 regulatory subunit B''gamma)