PARPBP (PARP1 binding protein)

Gene

• Entrez ID: 55010
• Gene name: PARP1 binding protein
• Gene symbol: PARPBP
• Synonyms (NCBI Gene): AROM, C12orf48, PARI
• Chromosome: 12
• Chromosome location: 12q23.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	22153967
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22153967
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IBA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IEA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IMP	22153967

Other IDs

• MIM: 613687
• HGNC: 26074
• e!Ensembl: ENSG00000185480

Protein

• UniProt ID: Q9NWS1
• Protein name: PCNA-interacting partner (PARI) (PARP-1 binding protein) (PARP1-binding protein) (PARPBP)
• Protein function: Required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. Antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologou
• Tissue specificity: TISSUE SPECIFICITY: Restricted to testis. Overexpressed in multiple cancer cells. {ECO:0000269|PubMed:20931645}.
• Sequence:

  MAVFNQKSVSDMIKEFRKNWRALCNSERTTLCGADSMLLALQLSMAENNKQHSGEFTVSL
  SDVLLTWKYLLHEKLNLPVENMDVTDHYEDVRKIYDDFLKNSNMLDLIDVYQKCRALTSN
  CENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNL
  LVNSKNDLAVAYILNIPDRGLGREAFTDLKHAAREKQMSIFLVATSFIRTIELGGKGYAP
  PPSDPLRTHVKGLSNFINFIDKLDEILGEIPNPSIAGGQILSVIKMQLIKGQNSRDPFCK
  AIEEVAQDLDLRIKNIINSQEGVVALSTTDISPARPKSHAINHGTAYCGRDTVKALLVLL
  DEEAANAPTKNKAELLYDEENTIHHHGTSILTLFRSPTQVNNSIKPLRERICVSMQEKKI
  KMKQTLIRSQFACTYKDDYMISKDNWNNVNLASKPLCVLYMENDLSEGVNPSVGRSTIGT
  SFGNVHLDRSKNEKVSRKSTSQTGNKSSKRKQVDLDGENILCDNRNEPPQHKNAKIPKKS
  NDSQNRLYGKLAKVAKSNKCTAKDKLISGQAKLTQFFRL

• Sequence length: 579

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinogenesis	Associate	36576436	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	35392038	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	31770211, 36576436	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Associate	36576436	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	35100974	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	35100974	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	36056690	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35100974	★☆☆☆☆ Found in Text Mining only