OXSM (3-oxoacyl-ACP synthase, mitochondrial)

Gene

• Entrez ID: 54995
• Gene name: 3-oxoacyl-ACP synthase, mitochondrial
• Gene symbol: OXSM
• Synonyms (NCBI Gene): CEM1, FASN2D, KASI, KS
• Chromosome: 3
• Chromosome location: 3p24.2
• Summary: This gene encodes a beta-ketoacyl synthetase. The encoded enzyme is required for elongation of fatty acid chains in the mitochondria. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1208661	hsa-miR-1179	CLIP-seq
MIRT1208662	hsa-miR-520d-5p	CLIP-seq
MIRT1208663	hsa-miR-524-5p	CLIP-seq
MIRT1208664	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004315	Function	3-oxoacyl-[acyl-carrier-protein] synthase activity	IBA
GO:0004315	Function	3-oxoacyl-[acyl-carrier-protein] synthase activity	IDA	15668256
GO:0004315	Function	3-oxoacyl-[acyl-carrier-protein] synthase activity	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	15668256
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IDA	15668256
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0051790	Process	Short-chain fatty acid biosynthetic process	IDA	15668256
GO:0051792	Process	Medium-chain fatty acid biosynthetic process	IDA	15668256

Other IDs

• MIM: 610324
• HGNC: 26063
• e!Ensembl: ENSG00000151093

Protein

• UniProt ID: Q9NWU1
• Protein name: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase)
• Protein function: May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function.
• PDB: 2C9H, 2IWY, 2IWZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00109	ketoacyl-synt	41 → 291	Beta-ketoacyl synthase, N-terminal domain	Domain
  PF02801	Ketoacyl-synt_C	299 → 414	Beta-ketoacyl synthase, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Higher expression in heart, skeletal muscle, liver and kidney which contain high levels of active mitochondria. {ECO:0000269|PubMed:15668256}.
• Sequence:

  MSNCLQNFLKITSTRLLCSRLCQQLRSKRKFFGTVPISRLHRRVVITGIGLVTPLGVGTH
  LVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTI
  MAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFV
  PKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCI
  SPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYA
  EVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAEN
  KAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEF
  DLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL

• Sequence length: 459

Pathways

KEGG:

Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Biosynthesis of cofactors