Gene Gene information from NCBI Gene database.
Entrez ID 54984
Gene name PIN2 (TERF1) interacting telomerase inhibitor 1
Gene symbol PINX1
Synonyms (NCBI Gene)
Gno1LPTLLPTSPxr1
Chromosome 8
Chromosome location 8p23.1
miRNA miRNA information provided by mirtarbase database.
105
miRTarBase ID miRNA Experiments Reference
MIRT043552 hsa-miR-331-3p CLASH 23622248
MIRT712989 hsa-miR-208a-5p HITS-CLIP 19536157
MIRT712988 hsa-miR-208b-5p HITS-CLIP 19536157
MIRT712987 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT712986 hsa-miR-2276-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0000228 Component Nuclear chromosome IDA 19393617
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 19393617
GO:0000776 Component Kinetochore IEA
GO:0000781 Component Chromosome, telomeric region IDA 11701125, 19265708, 21119197, 24415760
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606505 30046 ENSG00000254093
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96BK5
Protein name PIN2/TERF1-interacting telomerase inhibitor 1 (Liver-related putative tumor suppressor) (Pin2-interacting protein X1) (Protein 67-11-3) (TRF1-interacting protein 1)
Protein function Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor sup
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01585 G-patch 26 70 G-patch domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
Sequence
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQV
KNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKIS
KNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQE
YFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKP
ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKK
KLQKPVEIAEDATLEETLVKKKKKKDSK
Sequence length 328
Interactions View interactions