Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54984
Gene name Gene Name - the full gene name approved by the HGNC.
PIN2 (TERF1) interacting telomerase inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PINX1
Synonyms (NCBI Gene) Gene synonyms aliases
Gno1, LPTL, LPTS, Pxr1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p23.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043552 hsa-miR-331-3p CLASH 23622248
MIRT712989 hsa-miR-208a-5p HITS-CLIP 19536157
MIRT712988 hsa-miR-208b-5p HITS-CLIP 19536157
MIRT712987 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT712986 hsa-miR-2276-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000228 Component Nuclear chromosome IDA 19393617
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 19393617
GO:0000776 Component Kinetochore IEA
GO:0000781 Component Chromosome, telomeric region IDA 11701125, 19265708, 21119197, 24415760
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606505 30046 ENSG00000254093
Protein
UniProt ID Q96BK5
Protein name PIN2/TERF1-interacting telomerase inhibitor 1 (Liver-related putative tumor suppressor) (Pin2-interacting protein X1) (Protein 67-11-3) (TRF1-interacting protein 1)
Protein function Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor sup
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01585 G-patch 26 70 G-patch domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
Sequence
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQV
KNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKIS
KNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQE
YFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKP
ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKK
KLQKPVEIAEDATLEETLVKKKKKKDSK
Sequence length 328
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acne acne vulgaris N/A N/A GWAS
Diabetes Triglyceride levels in non-type 2 diabetes, Type 2 diabetes N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22527105
Breast Neoplasms Inhibit 24672800, 28586040
Carcinogenesis Associate 24672800
Carcinoma Hepatocellular Associate 12508358, 27221889
Carcinoma Non Small Cell Lung Associate 28815183
Drug Related Side Effects and Adverse Reactions Associate 25374231
Glioma Stimulate 26261583
Hepatitis B Associate 21056083
Hepatitis B Chronic Associate 27221889
Idiopathic Noncirrhotic Portal Hypertension Associate 24020493