Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54977
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 25 member 38
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC25A38
Synonyms (NCBI Gene) Gene synonyms aliases	SIDBA2
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the mitochondrial carrier family. The encoded protein is required during erythropoiesis and is important for the biosynthesis of heme. Mutations in this gene are the cause of autosomal congenital sideroblastic anemia (anemia, side

Show/Hide all(9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918330	C>T	Pathogenic	Stop gained, coding sequence variant
rs121918331	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs121918332	A>T	Pathogenic	Stop gained, intron variant, coding sequence variant
rs146864395	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs866266558	C>T	Pathogenic	Stop gained, coding sequence variant
rs869312029	G>A	Pathogenic	Splice acceptor variant
rs869320719	CT>-	Pathogenic, likely-pathogenic	Frameshift variant, coding sequence variant
rs1233124208	A>C,G	Pathogenic	Splice acceptor variant
rs1575247302	->T	Likely-pathogenic	Coding sequence variant, frameshift variant, intron variant

Show/Hide all(129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051268	hsa-miR-16-5p	CLASH	23622248
MIRT049071	hsa-miR-92a-3p	CLASH	23622248
MIRT047969	hsa-miR-30c-5p	CLASH	23622248
MIRT1356645	hsa-miR-101	CLIP-seq
MIRT1356646	hsa-miR-1303	CLIP-seq
MIRT1356647	hsa-miR-142-5p	CLIP-seq
MIRT1356648	hsa-miR-146a	CLIP-seq
MIRT1356649	hsa-miR-146b-5p	CLIP-seq
MIRT1356650	hsa-miR-181a	CLIP-seq
MIRT1356651	hsa-miR-181b	CLIP-seq
MIRT1356652	hsa-miR-181c	CLIP-seq
MIRT1356653	hsa-miR-181d	CLIP-seq
MIRT1356654	hsa-miR-186	CLIP-seq
MIRT1356655	hsa-miR-217	CLIP-seq
MIRT1356656	hsa-miR-298	CLIP-seq
MIRT1356657	hsa-miR-3117-3p	CLIP-seq
MIRT1356658	hsa-miR-3133	CLIP-seq
MIRT1356659	hsa-miR-3154	CLIP-seq
MIRT1356660	hsa-miR-3158-5p	CLIP-seq
MIRT1356661	hsa-miR-3169	CLIP-seq
MIRT1356662	hsa-miR-3975	CLIP-seq
MIRT1356663	hsa-miR-4257	CLIP-seq
MIRT1356664	hsa-miR-4262	CLIP-seq
MIRT1356665	hsa-miR-4326	CLIP-seq
MIRT1356666	hsa-miR-4418	CLIP-seq
MIRT1356667	hsa-miR-4464	CLIP-seq
MIRT1356668	hsa-miR-4748	CLIP-seq
MIRT1356669	hsa-miR-4759	CLIP-seq
MIRT1356670	hsa-miR-4761-3p	CLIP-seq
MIRT1356671	hsa-miR-509-3-5p	CLIP-seq
MIRT1356672	hsa-miR-509-5p	CLIP-seq
MIRT1356673	hsa-miR-543	CLIP-seq
MIRT1356674	hsa-miR-550b	CLIP-seq
MIRT1356675	hsa-miR-561	CLIP-seq
MIRT1356676	hsa-miR-589	CLIP-seq
MIRT1356677	hsa-miR-877	CLIP-seq
MIRT2105663	hsa-miR-1254	CLIP-seq
MIRT2105664	hsa-miR-129-3p	CLIP-seq
MIRT1356648	hsa-miR-146a	CLIP-seq
MIRT1356649	hsa-miR-146b-5p	CLIP-seq
MIRT2105665	hsa-miR-15a	CLIP-seq
MIRT2105666	hsa-miR-15b	CLIP-seq
MIRT2105667	hsa-miR-16	CLIP-seq
MIRT1356654	hsa-miR-186	CLIP-seq
MIRT2105668	hsa-miR-195	CLIP-seq
MIRT1356655	hsa-miR-217	CLIP-seq
MIRT1356656	hsa-miR-298	CLIP-seq
MIRT2105669	hsa-miR-3116	CLIP-seq
MIRT1356657	hsa-miR-3117-3p	CLIP-seq
MIRT1356658	hsa-miR-3133	CLIP-seq
MIRT1356660	hsa-miR-3158-5p	CLIP-seq
MIRT1356661	hsa-miR-3169	CLIP-seq
MIRT2105670	hsa-miR-3180-5p	CLIP-seq
MIRT2105671	hsa-miR-3653	CLIP-seq
MIRT2105672	hsa-miR-424	CLIP-seq
MIRT2105673	hsa-miR-4251	CLIP-seq
MIRT2105674	hsa-miR-4252	CLIP-seq
MIRT1356666	hsa-miR-4418	CLIP-seq
MIRT2105675	hsa-miR-4504	CLIP-seq
MIRT2105676	hsa-miR-4668-5p	CLIP-seq
MIRT2105677	hsa-miR-4727-5p	CLIP-seq
MIRT1356669	hsa-miR-4759	CLIP-seq
MIRT2105678	hsa-miR-497	CLIP-seq
MIRT1356671	hsa-miR-509-3-5p	CLIP-seq
MIRT1356672	hsa-miR-509-5p	CLIP-seq
MIRT2105679	hsa-miR-542-3p	CLIP-seq
MIRT2105680	hsa-miR-544	CLIP-seq
MIRT2105681	hsa-miR-548an	CLIP-seq
MIRT2105682	hsa-miR-549	CLIP-seq
MIRT1356674	hsa-miR-550b	CLIP-seq
MIRT2105683	hsa-miR-570	CLIP-seq
MIRT1356676	hsa-miR-589	CLIP-seq
MIRT2105684	hsa-miR-595	CLIP-seq
MIRT2105685	hsa-miR-661	CLIP-seq
MIRT2330190	hsa-miR-1253	CLIP-seq
MIRT2330191	hsa-miR-3921	CLIP-seq
MIRT2330192	hsa-miR-3925-3p	CLIP-seq
MIRT2105673	hsa-miR-4251	CLIP-seq
MIRT2330193	hsa-miR-4329	CLIP-seq
MIRT2330194	hsa-miR-4653-5p	CLIP-seq
MIRT2330195	hsa-miR-515-5p	CLIP-seq
MIRT2330196	hsa-miR-520a-5p	CLIP-seq
MIRT2330197	hsa-miR-525-5p	CLIP-seq
MIRT2330198	hsa-miR-766	CLIP-seq
MIRT2105663	hsa-miR-1254	CLIP-seq
MIRT2624234	hsa-miR-1270	CLIP-seq
MIRT2624235	hsa-miR-1343	CLIP-seq
MIRT2624236	hsa-miR-1976	CLIP-seq
MIRT2624237	hsa-miR-219-2-3p	CLIP-seq
MIRT2624238	hsa-miR-2964a-3p	CLIP-seq
MIRT2105669	hsa-miR-3116	CLIP-seq
MIRT2624239	hsa-miR-3153	CLIP-seq
MIRT2105670	hsa-miR-3180-5p	CLIP-seq
MIRT2624240	hsa-miR-3591-3p	CLIP-seq
MIRT2624241	hsa-miR-3691-3p	CLIP-seq
MIRT2624242	hsa-miR-3929	CLIP-seq
MIRT2624243	hsa-miR-3936	CLIP-seq
MIRT2624244	hsa-miR-4279	CLIP-seq
MIRT2624245	hsa-miR-4419b	CLIP-seq
MIRT2624246	hsa-miR-4450	CLIP-seq
MIRT2624247	hsa-miR-4478	CLIP-seq
MIRT2624248	hsa-miR-4493	CLIP-seq
MIRT2624249	hsa-miR-4531	CLIP-seq
MIRT2624250	hsa-miR-4646-5p	CLIP-seq
MIRT2105676	hsa-miR-4668-5p	CLIP-seq
MIRT2624251	hsa-miR-4683	CLIP-seq
MIRT2624252	hsa-miR-4724-5p	CLIP-seq
MIRT2105677	hsa-miR-4727-5p	CLIP-seq
MIRT2624253	hsa-miR-532-5p	CLIP-seq
MIRT2105680	hsa-miR-544	CLIP-seq
MIRT2105681	hsa-miR-548an	CLIP-seq
MIRT2624254	hsa-miR-562	CLIP-seq
MIRT2624255	hsa-miR-620	CLIP-seq
MIRT2624256	hsa-miR-648	CLIP-seq
MIRT2105685	hsa-miR-661	CLIP-seq
MIRT2624235	hsa-miR-1343	CLIP-seq
MIRT2624236	hsa-miR-1976	CLIP-seq
MIRT2624237	hsa-miR-219-2-3p	CLIP-seq
MIRT2624238	hsa-miR-2964a-3p	CLIP-seq
MIRT2624239	hsa-miR-3153	CLIP-seq
MIRT2624240	hsa-miR-3591-3p	CLIP-seq
MIRT2624241	hsa-miR-3691-3p	CLIP-seq
MIRT2691021	hsa-miR-4330	CLIP-seq
MIRT2624250	hsa-miR-4646-5p	CLIP-seq
MIRT2105676	hsa-miR-4668-5p	CLIP-seq
MIRT2624253	hsa-miR-532-5p	CLIP-seq
MIRT2624254	hsa-miR-562	CLIP-seq
MIRT2624256	hsa-miR-648	CLIP-seq
MIRT2691022	hsa-miR-759	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0006783	Process	Heme biosynthetic process	TAS	19412178
GO:0015187	Function	Glycine transmembrane transporter activity	IBA
GO:0015187	Function	Glycine transmembrane transporter activity	IEA
GO:0015187	Function	Glycine transmembrane transporter activity	IMP	27476175
GO:0016020	Component	Membrane	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	19412178
GO:1904983	Process	Glycine import into mitochondrion	IBA
GO:1904983	Process	Glycine import into mitochondrion	IEA
GO:1904983	Process	Glycine import into mitochondrion	IMP	27476175

MIM	HGNC	e!Ensembl
610819	26054	ENSG00000144659

Protein

UniProt ID

Q96DW6

Protein name

Mitochondrial glycine transporter (Appoptosin) (Mitochondrial glycine transporter GlyC) (Solute carrier family 25 member 38)

Protein function

Mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. Plays an important role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-amin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	24 → 119	Mitochondrial carrier protein	Family
PF00153	Mito_carr	119 → 210	Mitochondrial carrier protein	Family
PF00153	Mito_carr	214 → 304	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in erythroid cells. {ECO:0000269|PubMed:19412178}.

Sequence

MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQP
SDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHP
PTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSG
LTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADV
IKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKM
GLKS

Sequence length

304

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Anemia	Sideroblastic anemia 2	rs146864395, rs1575247302, rs121918330, rs869320719, rs869312029, rs121918332, rs1233124208, rs1293528130	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diverticulitis	Diverticulitis	N/A	N/A	GWAS
Sideroblastic Anemia, X-Linked	X-linked sideroblastic anemia 1	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Stimulate	25891083
Alzheimer Disease	Associate	26813789
Anemia	Associate	39519257
Anemia Hemolytic	Associate	31338833
Anemia hypochromic microcytic	Associate	21393332
Anemia Refractory	Associate	25955609
Anemia Sideroblastic	Associate	21393332, 25985931, 38360212, 39519257, 39769087
Cockayne Syndrome	Associate	19731322
Endometrial Neoplasms	Associate	37509133
Iron Deficiencies	Associate	38360212
Leukemia Erythroblastic Acute	Associate	39769087
Neoplasm Metastasis	Associate	34434692
Nerve Degeneration	Stimulate	26813789
Sideroblastic anemia autosomal	Associate	21393332
Sleep Deprivation	Stimulate	26813789
Uveal melanoma	Associate	34434692
X linked sideroblastic anemia	Associate	31338833

SLC25A38 (solute carrier family 25 member 38)