Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54973
Gene name Gene Name - the full gene name approved by the HGNC.	Integrator complex subunit 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INTS11
Synonyms (NCBI Gene) Gene synonyms aliases	CPSF3L, CPSF73L, INT11, NEDMLOB, PSF3L, RC-68, RC68
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.33
Summary Summary of gene provided in NCBI Entrez Gene.	The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 18

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004521	Function	RNA endonuclease activity	IBA
GO:0004521	Function	RNA endonuclease activity	IDA	32697989, 33243860, 33548203, 34762484, 37080207, 38570683, 39032489
GO:0004521	Function	RNA endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IMP	16239144
GO:0005515	Function	Protein binding	IPI	16239144
GO:0005515	Function	Protein binding	IPI	24981860, 28396433, 32296183, 32647223, 33548203, 33686175, 33961781, 36180473
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	29471365, 39032489, 39032490
GO:0005634	Component	Nucleus	IDA	23904267
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	32647223
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	23904267, 29471365
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9852112
GO:0016180	Process	SnRNA processing	IBA
GO:0016180	Process	SnRNA processing	IDA	16239144
GO:0016180	Process	SnRNA processing	NAS	16239144
GO:0016787	Function	Hydrolase activity	IEA
GO:0032039	Component	Integrator complex	IDA	16239144, 29471365, 32697989, 33548203, 36920904, 39032489, 39032490
GO:0032039	Component	Integrator complex	IEA
GO:0032039	Component	Integrator complex	NAS	33548203
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	NAS	32697989
GO:0034472	Process	SnRNA 3'-end processing	IDA	22252320
GO:0046872	Function	Metal ion binding	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0160232	Component	INTAC complex	IDA	33243860, 34762484, 36869814, 37080207, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	32697989, 33243860, 33385327, 34762484, 37080207, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IEA

MIM	HGNC	e!Ensembl
611354	26052	ENSG00000127054

Protein

UniProt ID

Q5TA45

Protein name

Integrator complex subunit 11 (Int11) (EC 3.1.27.-) (Cleavage and polyadenylation-specific factor 3-like protein) (CPSF3-like protein) (Protein related to CPSF subunits of 68 kDa) (RC-68)

Protein function

RNA endonuclease component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:16239144, PubMed:25201415, PubMed:28396433, PubMed:32697989, P

PDB

5V8W , 7BFP , 7BFQ , 7CUN , 7PKS , 7YCX , 8R22 , 8R23 , 8R2D , 8RBX , 8RBZ , 8RC4 , 8UIB , 8YJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16661	Lactamase_B_6	21 → 207	Metallo-beta-lactamase superfamily domain	Domain
PF10996	Beta-Casp	245 → 363	Beta-Casp domain	Domain
PF07521	RMMBL	377 → 438	Zn-dependent metallo-hydrolase RNA specificity domain	Motif

Sequence

MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDF
LDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANF
FTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYN
MTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVF
ALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMF
EFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVG
HKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKM
EFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLH
GTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKD
HCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS

Sequence length

600

Interactions

View interactions

	Reactome
			RNA polymerase II transcribes snRNA genes

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Neurodevelopmental Disorders	complex neurodevelopmental disorder	N/A	N/A	GenCC
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	34551776
Neoplasms	Associate	32108034

INTS11 (integrator complex subunit 11)