ODAM (odontogenic, ameloblast associated)

Gene

• Entrez ID: 54959
• Gene name: Odontogenic, ameloblast associated
• Gene symbol: ODAM
• Synonyms (NCBI Gene): APIN
• Chromosome: 4
• Chromosome location: 4q13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029400	hsa-miR-26b-5p	Microarray	19088304
MIRT2058371	hsa-miR-3682-5p	CLIP-seq
MIRT2058372	hsa-miR-4277	CLIP-seq
MIRT2058373	hsa-miR-4705	CLIP-seq
MIRT2286684	hsa-miR-338-5p	CLIP-seq
MIRT2286685	hsa-miR-485-3p	CLIP-seq
MIRT2286686	hsa-miR-487a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	25911094
GO:0005515	Function	Protein binding	IPI	25911094, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	25911094
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25911094
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25911094
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006954	Process	Inflammatory response	IDA	25911094
GO:0009611	Process	Response to wounding	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	25911094
GO:0031214	Process	Biomineral tissue development	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IBA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEP	16674676
GO:0043547	Process	Positive regulation of GTPase activity	IMP	25911094
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IEP	25911094
GO:0071944	Component	Cell periphery	IDA	25911094
GO:0072686	Component	Mitotic spindle	IDA
GO:0099512	Component	Supramolecular fiber	IDA	14647039

Other IDs

• MIM: 614843
• HGNC: 26043
• e!Ensembl: ENSG00000109205

Protein

• UniProt ID: A1E959
• Protein name: Odontogenic ameloblast-associated protein (Apin)
• Protein function: Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involv
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15424	ODAM	16 → 279	Odontogenic ameloblast-associated family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the junctional epithelium of healthy teeth. In periodontitis, absent in the pocket epithelium of the diseased periodontium but is detected in the gingival crevicular fluid. {ECO:0000269|PubMed:25911094}.
• Sequence:

  MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGI
  LQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ
  PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFY
  AQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVF
  MPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

• Sequence length: 279

Pathways

Reactome:

Amyloid fiber formation

<