Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54949
Gene name Gene Name - the full gene name approved by the HGNC.
Succinate dehydrogenase complex assembly factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDHAF2
Synonyms (NCBI Gene) Gene synonyms aliases
C11orf79, PGL2, PPGL2, SDH5, hSDH5
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.[provided by RefSeq, Jul 2010]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113560320 G>A Pathogenic Missense variant, coding sequence variant
rs375280597 A>G Uncertain-significance, likely-pathogenic Splice acceptor variant
rs745989557 A>G,T Likely-pathogenic Splice acceptor variant
rs749527870 G>A Likely-pathogenic Splice donor variant
rs750979204 T>A,C Likely-pathogenic Stop gained, synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031763 hsa-miR-16-5p Proteomics 18668040
MIRT720579 hsa-miR-5586-5p HITS-CLIP 19536157
MIRT720578 hsa-miR-425-5p HITS-CLIP 19536157
MIRT720577 hsa-miR-4530 HITS-CLIP 19536157
MIRT720576 hsa-miR-338-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19628817, 26496610, 28514442, 32296183, 33961781
GO:0005730 Component Nucleolus IDA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 19628817
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613019 26034 ENSG00000167985
Protein
UniProt ID Q9NX18
Protein name Succinate dehydrogenase assembly factor 2, mitochondrial (SDH assembly factor 2) (SDHAF2)
Protein function Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chai
PDB 6VAX , 8DYD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03937 Sdh5 67 140 Flavinator of succinate dehydrogenase Domain
Sequence
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALL
RDFAKNKNKEQRLRAPDLEYLFEKPR
Sequence length 166
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary Pheochromocytoma-Paraganglioma hereditary pheochromocytoma-paraganglioma rs749527870, rs753554501, rs1554984631, rs745989557, rs761956866, rs750979204, rs949388785, rs113560320, rs774508076 N/A
Paraganglioma Paragangliomas 2 rs753554501, rs761956866, rs113560320 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
ovarian cancer Ovarian cancer N/A N/A ClinVar
Pheochromocytoma pheochromocytoma N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 33560870
Cholangiocarcinoma Associate 35841118
Cluster Headache Associate 27659016
Head and Neck Neoplasms Associate 21224366
Neoplasms Associate 19628817, 21224366, 28099933
Neoplasms Inhibit 22972948
Neoplastic Syndromes Hereditary Associate 19628817, 20484225, 22972948, 28099933
Neuroendocrine Tumors Associate 19628817
Ovarian Neoplasms Associate 33560870
Paraganglioma Associate 16080474, 19628817, 19732718, 22972948, 24466223, 25459911, 27659016, 28099933, 28384794, 8981955