Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54899
Gene name Gene Name - the full gene name approved by the HGNC.
PX domain containing serine/threonine kinase like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PXK
Synonyms (NCBI Gene) Gene synonyms aliases
MONAKA, SLOB
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a phox (PX) domain-containing protein which may be involved in synaptic transmission and the ligand-induced internalization and degradation of epidermal growth factors. Variations in this gene may be associated with susceptibility to sys
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037408 hsa-miR-744-5p CLASH 23622248
MIRT469870 hsa-miR-301a-3p HITS-CLIP 21572407
MIRT469869 hsa-miR-454-3p HITS-CLIP 21572407
MIRT469868 hsa-miR-130b-3p HITS-CLIP 21572407
MIRT469867 hsa-miR-130a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding NAS 16142408
GO:0003779 Function Actin binding IEA
GO:0004672 Function Protein kinase activity NAS 16142408
GO:0005515 Function Protein binding ISS 16135750
GO:0005524 Function ATP binding NAS 16142408
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611450 23326 ENSG00000168297
Protein
UniProt ID Q7Z7A4
Protein name PX domain-containing protein kinase-like protein (Modulator of Na,K-ATPase) (MONaKA)
Protein function Binds to and modulates brain Na,K-ATPase subunits ATP1B1 and ATP1B3 and may thereby participate in the regulation of electrical excitability and synaptic transmission. May not display kinase activity. {ECO:0000250|UniProtKB:Q8BX57, ECO:0000303|P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 42 122 PX domain Domain
PF02205 WH2 545 573 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed in all tissues examined except in heart. Isoform 1 is expressed in high levels in the brain, skeletal muscle, spleen and testis. Isoform 7 expression has yet to be demonstrated. {ECO:0000269|PubMed:16142408}.
Sequence
MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFD
LLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLD
PN
NYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSW
ADLGPDKYLSDKDFQCLIKLLPSCLHPYIYRVTFATANESSALLIRMFNEKGTLKDLIYK
AKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHASNVMLDGDT
CRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFP
PAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSA
KYSNSNNSAGSGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPAAPLPPASTEAPAQLS
SQAVNGMSRGALLSSIQNFQKGTLRKAKTCDHSAPKIG
Sequence length 578
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type ii diabetes, Type 2 diabetes (adjusted for BMI), Type 2 diabetes N/A N/A GWAS
Systemic lupus erythematosus systemic lupus erythematosus, Systemic lupus erythematosus N/A N/A GenCC, GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 22355377
Carcinoma Squamous Cell Associate 37487414
Glomerulonephritis IGA Associate 24458077
Liver Neoplasms Associate 30931641
Lupus Erythematosus Systemic Associate 18204446, 19442287, 24458077, 29070082, 33455918
Sjogren's Syndrome Associate 29070082
Tuberculosis Associate 36476775