PLPPR1 (phospholipid phosphatase related 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 54886
Gene name Phospholipid phosphatase related 1
Gene symbol PLPPR1
Synonyms (NCBI Gene)
LPPR1PRG-3PRG3
Chromosome 9
Chromosome location 9q31.1
Summary This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perfor
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
619590 25993 ENSG00000148123
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TBJ4
Protein name Phospholipid phosphatase-related protein type 1 (Inactive 2-lysophosphatidate phosphatase PLPPR1) (Lipid phosphate phosphatase-related protein type 1) (Plasticity-related gene 3 protein) (PRG-3)
Protein function May play a role in neurite outgrowth and neurogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 127 → 280 PAP2 superfamily Family
Sequence 
MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP
GTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPL
LRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGN
ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF
LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLM
AFPRIESPLETLSAQNHSASMTEVT
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    Lysosphingolipid and LPA receptors