PLPPR1 (phospholipid phosphatase related 1)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54886
Gene name Gene Name - the full gene name approved by the HGNC.
Phospholipid phosphatase related 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLPPR1
Synonyms (NCBI Gene) Gene synonyms aliases
LPPR1, PRG-3, PRG3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perfor
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0005887 Component Integral component of plasma membrane IBA 21873635
GO:0006644 Process Phospholipid metabolic process IBA 21873635
GO:0007165 Process Signal transduction IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
619590 25993 ENSG00000148123
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8TBJ4
Protein name Phospholipid phosphatase-related protein type 1 (Inactive 2-lysophosphatidate phosphatase PLPPR1) (Lipid phosphate phosphatase-related protein type 1) (Plasticity-related gene 3 protein) (PRG-3)
Protein function May play a role in neurite outgrowth and neurogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 127 → 280 PAP2 superfamily Family
Sequence 
MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP
GTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPL
LRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGN
ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF
LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLM
AFPRIESPLETLSAQNHSASMTEVT
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Lysosphingolipid and LPA receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Parkinson disease Parkinson Disease rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432
View all (84 more)		 30338293
Seizure Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061
View all (179 more)		 23266720
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 29965997