WBP1L (WW domain binding protein 1 like)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 54838
Gene name WW domain binding protein 1 like
Gene symbol WBP1L
Synonyms (NCBI Gene)
C10orf26OPA1LOPAL1
Chromosome 10
Chromosome location 10q24.32
miRNA miRNA information provided by mirtarbase database.
28
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (28)
miRTarBase ID miRNA Experiments Reference
MIRT017867 hsa-miR-335-5p Microarray 18185580
MIRT020792 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT031188 hsa-miR-19b-3p Sequencing 20371350
MIRT044576 hsa-miR-320a CLASH 23622248
MIRT040377 hsa-miR-615-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0016020 Component Membrane IEA
GO:0030097 Process Hemopoiesis IEA
GO:0031398 Process Positive regulation of protein ubiquitination IEA
GO:0031625 Function Ubiquitin protein ligase binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611129 23510 ENSG00000166272
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NX94
Protein name WW domain binding protein 1-like (Outcome predictor in acute leukemia 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11669 WBP-1 22 → 123 WW domain-binding protein 1 Family
Sequence 
MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCV
CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPP
PYSAFQLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPS
DLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTP
GRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLC
QSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS
Sequence length 342
Interactions View interactions