Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54838
Gene name Gene Name - the full gene name approved by the HGNC.
WW domain binding protein 1 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WBP1L
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf26, OPA1L, OPAL1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017867 hsa-miR-335-5p Microarray 18185580
MIRT020792 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT031188 hsa-miR-19b-3p Sequencing 20371350
MIRT044576 hsa-miR-320a CLASH 23622248
MIRT040377 hsa-miR-615-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0016020 Component Membrane IEA
GO:0030097 Process Hemopoiesis IEA
GO:0031398 Process Positive regulation of protein ubiquitination IEA
GO:0031625 Function Ubiquitin protein ligase binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611129 23510 ENSG00000166272
Protein
UniProt ID Q9NX94
Protein name WW domain binding protein 1-like (Outcome predictor in acute leukemia 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11669 WBP-1 22 123 WW domain-binding protein 1 Family
Sequence
MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCV
CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPP
PYS
AFQLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPS
DLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTP
GRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLC
QSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS
Sequence length 342
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Asthma Asthma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Lymphoma Associate 33883344
Lymphoma B Cell Associate 33883344
Schizophrenia Associate 22883350