ZNF562 (zinc finger protein 562)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54811
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 562
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF562
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2112)
miRTarBase ID miRNA Experiments Reference
MIRT025146 hsa-miR-181a-5p Microarray 17612493
MIRT044315 hsa-miR-106b-5p CLASH 23622248
MIRT552385 hsa-miR-8485 HITS-CLIP 19536157
MIRT552384 hsa-miR-329-3p HITS-CLIP 19536157
MIRT552383 hsa-miR-362-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of transcription, DNA-templated IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q6V9R5
Protein name Zinc finger protein 562
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 40 → 81 KRAB box Family
PF00096 zf-C2H2 204 → 226 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 262 → 282 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 288 → 310 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 316 → 338 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 344 → 366 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 372 → 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 → 422 Zinc finger, C2H2 type Domain
Sequence 
MSAFDMSHGFFPREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDT
TQKYLYRDVMLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRS
YSGWKLCENCGEVFSEQFCLKTHMRAQNGGNTFEGNCYGKDSISVHKEASIGQELSKFNP
CGKVFTLTPGLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGIHIGEKLCEFQECERA
ITTSSHLKQCVAVHTGKKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNS
SSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLA
IHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLK
THSGER
Sequence length 426
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hypercholesterolemia Hypercholesterolemia, Familial rs28942111, rs28942112, rs137852912, rs121908025, rs28942082, rs28942083, rs121908028, rs121908030, rs28942079, rs28942084, rs121908032, rs387906302, rs387906303, rs121908033, rs121908034
View all (1161 more)		 22968135
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Diabetic Foot Associate 38287255