ZNF562 (zinc finger protein 562)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 54811
Gene name Zinc finger protein 562
Gene symbol ZNF562
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
2112
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2112)
miRTarBase ID miRNA Experiments Reference
MIRT025146 hsa-miR-181a-5p Microarray 17612493
MIRT044315 hsa-miR-106b-5p CLASH 23622248
MIRT552385 hsa-miR-8485 HITS-CLIP 19536157
MIRT552384 hsa-miR-329-3p HITS-CLIP 19536157
MIRT552383 hsa-miR-362-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6V9R5
Protein name Zinc finger protein 562
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 40 → 81 KRAB box Family
PF00096 zf-C2H2 204 → 226 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 262 → 282 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 288 → 310 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 316 → 338 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 344 → 366 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 372 → 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 → 422 Zinc finger, C2H2 type Domain
Sequence 
MSAFDMSHGFFPREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDT
TQKYLYRDVMLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRS
YSGWKLCENCGEVFSEQFCLKTHMRAQNGGNTFEGNCYGKDSISVHKEASIGQELSKFNP
CGKVFTLTPGLAVHLEILNGRQPYKCKECGKGFKYFASLDNHMGIHIGEKLCEFQECERA
ITTSSHLKQCVAVHTGKKSEKTKNCGKSFTNFSQLSAHAKTHKGEKSFECKECGRSFRNS
SSFNVHIQIHTGIKPHKCTECGKAFTRSTHLTQHVRTHTGIKPYECKECGQAFTQYTGLA
IHIRNHTGEKPYQCKECGKAFNRSSTLTQHRRIHTGEKPYECVECGKTFITSSHRSKHLK
THSGER
Sequence length 426
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Uncertain significance rs759010276 RCV005927172
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Diabetic Foot Associate 38287255