Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54742
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member K
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6K
Synonyms (NCBI Gene) Gene synonyms aliases
CT97, HSJ001348, URLC10, ly-6K
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001541 hsa-miR-155-5p pSILAC 18668040
MIRT001541 hsa-miR-155-5p Proteomics;Other 18668040
MIRT031622 hsa-miR-16-5p Proteomics 18668040
MIRT720692 hsa-miR-5683 HITS-CLIP 19536157
MIRT720691 hsa-miR-6783-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA 21873635
GO:0001669 Component Acrosomal vesicle ISS
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane ISS
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615093 24225 ENSG00000160886
Protein
UniProt ID Q17RY6
Protein name Lymphocyte antigen 6K (Ly-6K)
Protein function Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis (at protein level). {ECO:0000269|PubMed:12516096, ECO:0000269|PubMed:18089789}.
Sequence
MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY
CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS
Sequence length 165
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Gastric ulcer Gastric ulcer GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 22988241, 27304060
Breast Neoplasms Stimulate 26862846
Carcinogenesis Associate 26862846, 30696738
Carcinoma Ovarian Epithelial Associate 36768616
Cell Transformation Neoplastic Stimulate 32055849
Central Nervous System Infections Associate 26862846
Epstein Barr Virus Infections Associate 32532891
Esophageal Neoplasms Associate 32500232
Esophageal Squamous Cell Carcinoma Associate 18452554
Glioblastoma Associate 32055849