Gene Gene information from NCBI Gene database.
Entrez ID 54742
Gene name Lymphocyte antigen 6 family member K
Gene symbol LY6K
Synonyms (NCBI Gene)
CT97HSJ001348URLC10ly-6K
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
107
miRTarBase ID miRNA Experiments Reference
MIRT001541 hsa-miR-155-5p pSILAC 18668040
MIRT001541 hsa-miR-155-5p Proteomics;Other 18668040
MIRT031622 hsa-miR-16-5p Proteomics 18668040
MIRT720692 hsa-miR-5683 HITS-CLIP 19536157
MIRT720691 hsa-miR-6783-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA
GO:0001669 Component Acrosomal vesicle IEA
GO:0001669 Component Acrosomal vesicle ISS
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615093 24225 ENSG00000160886
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q17RY6
Protein name Lymphocyte antigen 6K (Ly-6K)
Protein function Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis (at protein level). {ECO:0000269|PubMed:12516096, ECO:0000269|PubMed:18089789}.
Sequence
MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY
CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS
Sequence length 165
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins