Gene Gene information from NCBI Gene database.
Entrez ID 54739
Gene name XIAP associated factor 1
Gene symbol XAF1
Synonyms (NCBI Gene)
BIRC4BPHSXIAPAF1XIAPAF1
Chromosome 17
Chromosome location 17p13.1
Summary This gene encodes a protein which binds to and counteracts the inhibitory effect of a member of the IAP (inhibitor of apoptosis) protein family. IAP proteins bind to and inhibit caspases which are activated during apoptosis. The proportion of IAPs and pro
miRNA miRNA information provided by mirtarbase database.
501
miRTarBase ID miRNA Experiments Reference
MIRT018358 hsa-miR-335-5p Microarray 18185580
MIRT020845 hsa-miR-155-5p Other 20584899
MIRT1495091 hsa-miR-1183 CLIP-seq
MIRT1495092 hsa-miR-1207-5p CLIP-seq
MIRT1495093 hsa-miR-122 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
STAT1 Unknown 18035482
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IC 36394357
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606717 30932 ENSG00000132530
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6GPH4
Protein name XIAP-associated factor 1 (BIRC4-binding protein)
Protein function Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-in
PDB 2LXW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18608 XAF1_C 248 301 XIAP-associated factor 1 C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expression is frequently down-regulated in cancer cell lines. Isoform 5 is widely expressed. Expressed in placenta (at protein level). {ECO:0000269|PubMed:11175744, ECO:0000269|PubMed:16343440, ECO:0000269|PubMed:1732
Sequence
MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCT
MCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIM
HRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKK
HFPVGNPEILPSSLPSQAAENQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLD
PLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNF
S
Sequence length 301
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon alpha/beta signaling