FEV (FEV transcription factor, ETS family member)

Gene

• Entrez ID: 54738
• Gene name: FEV transcription factor, ETS family member
• Gene symbol: FEV
• Synonyms (NCBI Gene): HSRNAFEV, PET-1
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT994888	hsa-miR-3125	CLIP-seq
MIRT994889	hsa-miR-3609	CLIP-seq
MIRT994890	hsa-miR-3916	CLIP-seq
MIRT994891	hsa-miR-548ah	CLIP-seq
MIRT994892	hsa-miR-548t	CLIP-seq
MIRT994893	hsa-miR-563	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994895	hsa-miR-877	CLIP-seq
MIRT2229088	hsa-miR-4476	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607150
• HGNC: 18562
• e!Ensembl: ENSG00000163497

Protein

• UniProt ID: Q99581
• Protein name: Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)
• Protein function: Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0
• PDB: 2YPR, 3ZP5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00178	Ets	48 → 127	Ets-domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO:0000269|PubMed:15003288, ECO:0000269|PubMed:1
• Sequence:

  MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
  ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
  RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
  MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

• Sequence length: 238

Pathways

KEGG:

Transcriptional misregulation in cancer

<