Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	54738
Gene name	FEV transcription factor, ETS family member
Gene symbol	FEV
Synonyms (NCBI Gene)	HSRNAFEVPET-1
Chromosome	2
Chromosome location	2q35
Summary	This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT994888	hsa-miR-3125	CLIP-seq
MIRT994889	hsa-miR-3609	CLIP-seq
MIRT994890	hsa-miR-3916	CLIP-seq
MIRT994891	hsa-miR-548ah	CLIP-seq
MIRT994892	hsa-miR-548t	CLIP-seq
MIRT994893	hsa-miR-563	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994895	hsa-miR-877	CLIP-seq
MIRT2229088	hsa-miR-4476	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
607150	18562	ENSG00000163497

Q99581

Protein name

Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)

Protein function

Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0

PDB

2YPR , 3ZP5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00178	Ets	48 → 127	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO:0000269|PubMed:15003288, ECO:0000269|PubMed:1

Sequence

MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

Sequence length

238

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

FEV (FEV transcription factor, ETS family member)