Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54738
Gene name Gene Name - the full gene name approved by the HGNC.	FEV transcription factor, ETS family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FEV
Synonyms (NCBI Gene) Gene synonyms aliases	HSRNAFEV, PET-1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT994888	hsa-miR-3125	CLIP-seq
MIRT994889	hsa-miR-3609	CLIP-seq
MIRT994890	hsa-miR-3916	CLIP-seq
MIRT994891	hsa-miR-548ah	CLIP-seq
MIRT994892	hsa-miR-548t	CLIP-seq
MIRT994893	hsa-miR-563	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994895	hsa-miR-877	CLIP-seq
MIRT2229088	hsa-miR-4476	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0042551	Process	Neuron maturation	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
607150	18562	ENSG00000163497

Protein

UniProt ID

Q99581

Protein name

Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)

Protein function

Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0

PDB

2YPR , 3ZP5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00178	Ets	48 → 127	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO:0000269|PubMed:15003288, ECO:0000269|PubMed:1

Sequence

MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

Sequence length

238

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728 View all (51 more)	31209396

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		24100022	ClinVar

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	34477243
Autism Spectrum Disorder	Associate	31209396
Carcinogenesis	Stimulate	38308202
Mental Disorders	Associate	15986391
Neoplasm Metastasis	Inhibit	35548776
Neoplasms	Associate	17690209
Neoplasms	Inhibit	35548776
Personality Disorders	Associate	31756779
Prostatic Neoplasms	Associate	35548776
Rh Null Regulator Type	Associate	25866208
Sarcoma Ewing	Associate	12186432, 17334332, 17620387, 31756779, 32362012
Sarcoma Small Cell	Associate	17690209

FEV (FEV transcription factor, ETS family member)