Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54714
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclic nucleotide gated channel subunit beta 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNGB3
Synonyms (NCBI Gene) Gene synonyms aliases
ACHM1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the beta subunit of a cyclic nucleotide-gated ion channel. The encoded beta subunit appears to play a role in modulation of channel function in cone photoreceptors. This heterotetrameric channel is necessary for sensory transduction, and
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs6471482 A>C,G,T Pathogenic, benign Missense variant, stop gained, synonymous variant, coding sequence variant
rs35010099 A>G,T Benign, likely-pathogenic, uncertain-significance Coding sequence variant, missense variant
rs35365413 A>C,T Benign, uncertain-significance, likely-benign, pathogenic Coding sequence variant, missense variant
rs77277189 C>T Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, missense variant
rs115246141 A>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT735113 hsa-miR-17-5p qRT-PCR 31776299
MIRT899561 hsa-miR-1178 CLIP-seq
MIRT899562 hsa-miR-1270 CLIP-seq
MIRT899563 hsa-miR-1279 CLIP-seq
MIRT899564 hsa-miR-137 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001750 Component Photoreceptor outer segment IBA
GO:0001750 Component Photoreceptor outer segment IEA
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005221 Function Intracellularly cyclic nucleotide-activated monoatomic cation channel activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605080 2153 ENSG00000170289
Protein
UniProt ID Q9NQW8
Protein name Cyclic nucleotide-gated channel beta-3 (CNG channel beta-3) (Cone photoreceptor cGMP-gated channel subunit beta) (Cyclic nucleotide-gated cation channel beta-3) (Cyclic nucleotide-gated cation channel modulatory subunit)
Protein function Pore-forming subunit of the cone cyclic nucleotide-gated channel. Mediates cone photoresponses at bright light converting transient changes in intracellular cGMP levels into electrical signals. In the dark, cGMP levels are high and keep the chan
PDB 7RHS , 8ETP , 8EU3 , 8EUC , 8EV8 , 8EV9 , 8EVA , 8EVB , 8EVC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00027 cNMP_binding 542 631 Cyclic nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in the retina. {ECO:0000269|PubMed:10958649}.
Sequence
MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPV
TSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLYLLWLLLVTLAYNWNCCFIPLRL
VFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSNELRKHYRTSTKF
QLDVASIIPFDICYLFFGFNPMFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGYL
LFILHINACVYYWASNYEGIGTTRWVYDGEGNEYLRCYYWAVRTLITIGGLPEPQTLFEI
VFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVR
TWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRL
KSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGG
GNRRTANVVAHGFANLLTLDKKTLQEILVHY
PDSERILMKKARVLLKQKAKTAEATPPRK
DLALLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQ
KENEDKQKENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTS
RQSLIISMAPSAEGGEEVLTIEVKEKAKQ
Sequence length 809
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  cAMP signaling pathway  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Achromatopsia achromatopsia 3, achromatopsia rs6471482, rs1554608319, rs1057517454, rs1585942791, rs267606739, rs1052078370, rs201320564, rs1057516791, rs201794629, rs1554609943, rs372302139, rs1554612145, rs1554614038, rs772725807, rs1057516571
View all (92 more)
N/A
retinal dystrophy Retinal dystrophy rs372006750, rs761969118, rs267606739, rs772725807, rs786204762, rs201320564, rs1554612159, rs1822989898, rs397515360, rs373862340, rs1375507464, rs775796581, rs886063161, rs1000861056, rs764742792
View all (2 more)
N/A
Retinitis Pigmentosa retinitis pigmentosa rs397515360 N/A
cone-rod dystrophy Cone-rod dystrophy rs397515360 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aphasia Conduction Associate 35704304
Channelopathies Associate 26473621
Choroideremia Associate 23940504
Color Vision Defects Associate 12205108, 14715947, 18636117, 20454696, 22901948, 23940504, 24504161, 24676353, 25277229, 25558176, 27479814, 28145975, 29618791, 30826882, 31237654
View all (14 more)
Color Vision Defects Stimulate 37172884
Cone Dystrophy Associate 28746191
Cone Rod Dystrophies Associate 23776498, 23940504
Enhanced S Cone Syndrome Associate 32881472
Leber Congenital Amaurosis Associate 23940504
Myopia Associate 31776299