PPARG (peroxisome proliferator activated receptor gamma)

Gene

• Entrez ID: 5468
• Gene name: Peroxisome proliferator activated receptor gamma
• Gene symbol: PPARG
• Synonyms (NCBI Gene): CIMT1, FPLD3, GLM1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma
• Chromosome: 3
• Chromosome location: 3p25.2
• Summary: This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800571	C>A	Pathogenic	Coding sequence variant, missense variant, 5 prime UTR variant
rs1805192	C>G	Risk-factor	Coding sequence variant, missense variant, 5 prime UTR variant
rs28936407	G>A	Pathogenic	Genic downstream transcript variant, intron variant, missense variant, coding sequence variant
rs72551362	G>A	Pathogenic	Intron variant, coding sequence variant, genic downstream transcript variant, missense variant
rs72551363	T>A	Pathogenic	Intron variant, coding sequence variant, genic downstream transcript variant, missense variant
rs72551364	C>T	Pathogenic	Coding sequence variant, genic downstream transcript variant, synonymous variant, missense variant
rs121909242	A>C	Pathogenic	Missense variant, intron variant, coding sequence variant, genic downstream transcript variant
rs121909243	A>T	Pathogenic	Stop gained, intron variant, coding sequence variant, genic downstream transcript variant
rs121909244	C>A,T	Likely-pathogenic, uncertain-significance	Missense variant, genic downstream transcript variant, coding sequence variant, 3 prime UTR variant
rs121909245	T>A	Pathogenic	Missense variant, coding sequence variant
rs121909246	C>T	Pathogenic	Missense variant, synonymous variant, coding sequence variant
rs148195788	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs587776687	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs770557781	C>-	Pathogenic	Coding sequence variant, 3 prime UTR variant, genic downstream transcript variant, frameshift variant
rs1378972597	T>C	Likely-pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant, intron variant
rs1553643326	A>G	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs1553647989	G>A	Likely-pathogenic	Missense variant, intron variant, coding sequence variant
rs1553650477	CTTGA>-	Pathogenic	Frameshift variant, genic downstream transcript variant, intron variant, coding sequence variant
rs1553653993	T>C	Likely-pathogenic	Genic downstream transcript variant, 3 prime UTR variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005023	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR	19800867
MIRT004000	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR	21042576
MIRT004000	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR	21042576
MIRT005489	hsa-miR-138-5p	qRT-PCR	20486779
MIRT005957	hsa-miR-130a-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005957	hsa-miR-130a-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005957	hsa-miR-130a-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005957	hsa-miR-130a-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005958	hsa-miR-130b-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005958	hsa-miR-130b-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005958	hsa-miR-130b-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005958	hsa-miR-130b-3p	GFP reporter assay, qRT-PCR, Western blot	21135128
MIRT005023	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	22120719
MIRT006754	hsa-miR-20a-5p	Luciferase reporter assay	21743293
MIRT006754	hsa-miR-20a-5p	Luciferase reporter assay	21743293
MIRT023678	hsa-miR-1-3p	Microarray	18668037
MIRT024414	hsa-miR-215-5p	Microarray	19074876
MIRT026368	hsa-miR-192-5p	Microarray	19074876
MIRT005957	hsa-miR-130a-3p	Microarray	22942087
MIRT439927	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439927	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005023	hsa-miR-27b-3p	5.0	26397063
MIRT054499	hsa-miR-27a-3p	qRT-PCR	25510894
MIRT005957	hsa-miR-130a-3p	Microarray, qRT-PCR, Western blot	26692941
MIRT005958	hsa-miR-130b-3p	qRT-PCR	26653558
MIRT005958	hsa-miR-130b-3p	qRT-PCR	26653558
MIRT005957	hsa-miR-130a-3p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT005957	hsa-miR-130a-3p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT005958	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27746169
MIRT005957	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26398698
MIRT005957	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26398698
MIRT005957	hsa-miR-130a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33658824
MIRT005957	hsa-miR-130a-3p	qRT-PCR	35187064
MIRT005958	hsa-miR-130b-3p	qRT-PCR	35187064
MIRT054499	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37667246
MIRT054499	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34831427
MIRT1251811	hsa-miR-128	CLIP-seq
MIRT1251812	hsa-miR-27a	CLIP-seq
MIRT1251813	hsa-miR-27b	CLIP-seq
MIRT1251814	hsa-miR-3140-3p	CLIP-seq
MIRT1251815	hsa-miR-5096	CLIP-seq
MIRT1251816	hsa-miR-513a-3p	CLIP-seq
MIRT1251817	hsa-miR-513a-5p	CLIP-seq
MIRT1251818	hsa-miR-1279	CLIP-seq
MIRT1251819	hsa-miR-3121-3p	CLIP-seq
MIRT1251820	hsa-miR-3163	CLIP-seq
MIRT1251821	hsa-miR-586	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX1	Activation	19059241
CEBPD	Activation	10649448;18619497;20971808
E2F1	Activation	12110166
E2F1	Unknown	20971808
E2F4	Repression	12110166
EGR1	Unknown	12011097
GATA2	Repression	19772889
KLF2	Repression	20693579
NCOR1	Repression	20462215
NR4A3	Repression	18855877
RB1	Unknown	20971808
SIRT1	Repression	15850715
SREBF1	Unknown	10409739
SREBF2	Unknown	10409739
UHRF1	Repression	22286757

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12700342
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18293083
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	25704091
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	25704091
GO:0001890	Process	Placenta development	ISS
GO:0003676	Function	Nucleic acid binding	EXP	19043829
GO:0003677	Function	DNA binding	IDA	18382765
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	ISS
GO:0003690	Function	Double-stranded DNA binding	IMP	19043829
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9568715
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	9568716, 10622252, 12955147, 16239304, 18293083
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004955	Function	Prostaglandin receptor activity	TAS	9568715
GO:0005515	Function	Protein binding	IPI	12040021, 12522104, 14701856, 15722453, 16239304, 17500595, 19043829, 19047629, 19846556, 20195357, 20211142, 20660480, 21478865, 21775429, 22078880, 22351778, 25609649, 32296183, 32814053, 35140242, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16271724, 18382765
GO:0005634	Component	Nucleus	IDA	9568716
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007584	Process	Response to nutrient	TAS	10973253
GO:0008217	Process	Regulation of blood pressure	IMP	10622252
GO:0008270	Function	Zinc ion binding	IDA	19043829
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	18382765
GO:0010628	Process	Positive regulation of gene expression	IGI	28467929
GO:0010628	Process	Positive regulation of gene expression	IMP	29182484
GO:0010628	Process	Positive regulation of gene expression	ISS	31023188
GO:0010629	Process	Negative regulation of gene expression	IDA	28467929
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	28467929
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	12700342, 19114110
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	24751522
GO:0010887	Process	Negative regulation of cholesterol storage	IBA
GO:0010887	Process	Negative regulation of cholesterol storage	IDA	19114110
GO:0010888	Process	Negative regulation of lipid storage	IEA
GO:0010888	Process	Negative regulation of lipid storage	ISS	29695452
GO:0015909	Process	Long-chain fatty acid transport	ISS
GO:0016525	Process	Negative regulation of angiogenesis	IDA
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030154	Process	Cell differentiation	IBA
GO:0030224	Process	Monocyte differentiation	IDA	9568716
GO:0030509	Process	BMP signaling pathway	IGI	18382765
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	31023188
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IGI	28467929
GO:0030514	Process	Negative regulation of BMP signaling pathway	IMP	21743293
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0031348	Process	Negative regulation of defense response	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032376	Process	Positive regulation of cholesterol transport	IDA	17611579
GO:0032869	Process	Cellular response to insulin stimulus	IMP	10622252
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0033993	Process	Response to lipid	ISS	9568715
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IDA	9568716, 12955147, 25704091
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IGI	28467929
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IMP	20622039
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	NAS	16373399
GO:0042277	Function	Peptide binding	IDA	19043829
GO:0042593	Process	Glucose homeostasis	IMP	10622252
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	16373399
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISS
GO:0042802	Function	Identical protein binding	IPI	17937915, 25609649
GO:0043235	Component	Receptor complex	IDA	19043829
GO:0043409	Process	Negative regulation of MAPK cascade	IDA	18382765
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	9568716
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045087	Process	Innate immune response	TAS	17145956
GO:0045165	Process	Cell fate commitment	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS	27910957
GO:0045668	Process	Negative regulation of osteoblast differentiation	IMP	21042576, 21743293
GO:0045834	Process	Positive regulation of lipid metabolic process	TAS	9568716
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19043829
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9568716
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9568715, 12700342, 16239304, 16373399, 17611579, 18293083, 24751522
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20622039, 29182484
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046965	Function	Nuclear retinoid X receptor binding	IDA	9568715
GO:0046965	Function	Nuclear retinoid X receptor binding	IPI	19043829
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	16239304
GO:0048469	Process	Cell maturation	IDA	9568716
GO:0048511	Process	Rhythmic process	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	18382765, 20622039, 31023188
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IGI	28467929
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IMP	29182484
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	ISS
GO:0050544	Function	Arachidonate binding	ISS	9568715
GO:0050692	Function	DNA binding domain binding	IDA	19043829
GO:0050693	Function	LBD domain binding	IDA	19043829
GO:0050699	Function	WW domain binding	IMP	22292086
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050872	Process	White fat cell differentiation	TAS	12588810
GO:0051049	Process	Regulation of transport	IEA
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0051393	Function	Alpha-actinin binding	IPI	22351778
GO:0055088	Process	Lipid homeostasis	TAS	9113987
GO:0060336	Process	Negative regulation of type II interferon-mediated signaling pathway	IMP	21268089
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IGI	28467929, 31023188
GO:0070165	Process	Positive regulation of adiponectin secretion	ISS	29695452
GO:0070412	Function	R-SMAD binding	IPI	31023188
GO:0070888	Function	E-box binding	ISS
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IDA	9568716
GO:0071456	Process	Cellular response to hypoxia	ISS	29695452
GO:0090258	Process	Negative regulation of mitochondrial fission	IMP	29182484
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	15258145
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	9568716, 16373399
GO:0097677	Function	STAT family protein binding	IPI	28467929
GO:0140077	Process	Positive regulation of lipoprotein transport	IDA	9568716
GO:0140297	Function	DNA-binding transcription factor binding	IDA	10622252
GO:0141193	Process	Nuclear receptor-mediated signaling pathway	IEA
GO:1900076	Process	Regulation of cellular response to insulin stimulus	NAS	16373399
GO:1901202	Process	Negative regulation of extracellular matrix assembly	IDA	25704091
GO:1902894	Process	Negative regulation of miRNA transcription	IDA	24751522
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	28522568
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	25704091
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS	29695452
GO:1903845	Process	Negative regulation of cellular response to transforming growth factor beta stimulus	IGI	28467929
GO:1904179	Process	Positive regulation of adipose tissue development	NAS	16373399
GO:1904597	Process	Negative regulation of connective tissue replacement involved in inflammatory response wound healing	ISS	29695452
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	28522568
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	24960162
GO:1904893	Process	Negative regulation of receptor signaling pathway via STAT	IDA	28467929
GO:1905461	Process	Positive regulation of vascular associated smooth muscle cell apoptotic process	IMP	28522568
GO:1905563	Process	Negative regulation of vascular endothelial cell proliferation	IMP	24244514, 24960162
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	18293083

Other IDs

• MIM: 601487
• HGNC: 9236
• e!Ensembl: ENSG00000132170

Protein

• UniProt ID: P37231
• Protein name: Peroxisome proliferator-activated receptor gamma (PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)
• Protein function: Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target
• PDB: 1FM6, 1FM9, 1I7I, 1K74, 1KNU, 1NYX, 1PRG, 1RDT, 1WM0, 1ZEO, 1ZGY, 2ATH, 2F4B, 2FVJ, 2G0G, 2G0H, 2GTK, 2HFP, 2HWQ, 2HWR, 2I4J, 2I4P, 2I4Z, 2OM9, 2P4Y, 2POB, 2PRG, 2Q59, 2Q5P, 2Q5S, 2Q61, 2Q6R, 2Q6S, 2Q8S, 2QMV, 2VSR, 2VST, 2VV0, 2VV1, 2VV2, 2VV3, 2VV4, 2XKW, 2YFE, 2ZK0, 2ZK1, 2ZK2, 2ZK3, 2ZK4, 2ZK5, 2ZK6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12577	PPARgamma_N	31 → 108	PPAR gamma N-terminal region	Family
  PF00105	zf-C4	137 → 205	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	299 → 486	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression in adipose tissue. Lower in skeletal muscle, spleen, heart and liver. Also detectable in placenta, lung and ovary. {ECO:0000269|PubMed:9065481}.
• Sequence:

  MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
  DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
  QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
  RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
  ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
  QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
  LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
  LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
  LQVIKKTETDMSLHPLLQEIYKDLY

• Sequence length: 505

Pathways

KEGG:

PPAR signaling pathway
Efferocytosis
AMPK signaling pathway
Longevity regulating pathway
Osteoclast differentiation
Thermogenesis
Non-alcoholic fatty liver disease
Huntington disease
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Lipid and atherosclerosis

Reactome:

PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Nuclear Receptor transcription pathway
Regulation of PTEN gene transcription

<

Associated diseases

Causal
Disease merge term	Disease name	dbSNP ID	References
Partial Lipodystrophy	pparg-related familial partial lipodystrophy	rs148195788, rs1553647989, rs1378972597, rs121909244, rs1553650477, rs72551362, rs1553653993, rs72551363, rs770557781, rs72551364, rs121909245, rs121909246, rs1553643326	N/A
neoplasm	Neoplasm	rs1553647989	N/A

Unknown
Disease merge term	Disease name	Evidence	References	Source
Diabetes	Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes (adjusted for BMI), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Waist-hip ratio and type 2 diabetes (pairwise), Type 2 diabetes (PheCode 250.2), Body mass index and type 2 diabetes (pairwise), Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Body fat percentage and type 2 diabetes (pairwise), Youth-onset type 2 diabetes, Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type ii diabetes, Type 2 diabetes	N/A	N/A	GWAS
Diabetes Mellitus	Type 2 diabetes mellitus	N/A	N/A	ClinVar
Glioma	Glioma susceptibility 1	N/A	N/A	ClinVar
Gout	Gout	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Leprosy	Leprosy	N/A	N/A	GWAS
Lipodystrophy	Berardinelli-Seip congenital lipodystrophy	N/A	N/A	GenCC
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Monogenic Diabetes	monogenic diabetes	N/A	N/A	ClinVar
Obesity	obesity	N/A	N/A	ClinVar
Periodontal Diseases	Periodontal disease	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
AA amyloidosis	Associate	15946122
Abortion Habitual	Inhibit	29949879
Abortion Spontaneous	Associate	17259396
Abruptio Placentae	Associate	30194050
Acne Vulgaris	Associate	16785159
Acth Independent Macronodular Adrenal Hyperplasia	Inhibit	38098864
Acute Coronary Syndrome	Associate	34239024
Adenocarcinoma	Associate	10984506, 25931782
Adenocarcinoma Follicular	Associate	12651598, 15238980, 15256783, 20056739, 23025542, 24510380, 24798894, 26649796, 29108474
Adenocarcinoma of Lung	Associate	22426809
Adenoma	Associate	15238980, 22363123, 23025542, 29108474
Adenoma	Inhibit	24129064
Adenoma Oxyphilic	Inhibit	15274390
Albuminuria	Associate	19720797, 25889595, 31912623, 35422762
Alzheimer Disease	Associate	15946122, 20164187, 28346566, 28427149, 29723294, 31175839, 33920138, 36982725, 37918553
Amaurosis Fugax	Associate	21709632
Anemia Aplastic	Stimulate	19772889
Anemia Sickle Cell	Associate	36952641
Aneurysm	Associate	26539497
Angiomyolipoma	Associate	11485907
Aniridia	Associate	40531840
Anorexia Nervosa	Associate	27483138
Anxiety Disorders	Associate	33849116
Aortic Aneurysm Abdominal	Associate	19438902, 28446225, 28912007, 33858751, 37737183
Aortic Aneurysm Familial Abdominal 1	Associate	26925780
Aphasia Conduction	Associate	40065360
Arrhythmogenic Right Ventricular Dysplasia	Associate	23354045, 33670616
Arthritis Rheumatoid	Stimulate	18302252
Arthropathy progressive pseudorheumatoid of childhood	Associate	22653647
Asthma	Associate	14718259, 19217272, 30087444, 31506535, 34456632, 36114491
Atherosclerosis	Associate	10681562, 11934839, 12028454, 14534304, 14675851, 15143161, 15533057, 17322631, 17492134, 17681149, 18195488, 18362424, 19228871, 19888469, 20334678, 21206011, 21700710, 21709632, 21726861, 24371822, 25159899, 25595457, 29077145, 30697628, 34243632, 35543243, 36303246, 9665460, 9714568, 9831704
Atherosclerosis	Inhibit	11861426, 16311343, 19814730, 20334678, 22653647
Atrial Fibrillation	Inhibit	19569080
Atrophy	Associate	21482872
Atypical Squamous Cells of the Cervix	Associate	29469940
Autoimmune Diseases	Associate	22446964
Bacterial Infections	Associate	23349676
Benign Paroxysmal Positional Vertigo	Inhibit	27203679
Bipolar Disorder	Associate	39191171
Body Weight	Associate	19543210, 26865646
Bone Neoplasms	Associate	35922782
Brain Diseases	Associate	18710415, 21605119
Brain Diseases Metabolic Inborn	Associate	18076675
Brain Neoplasms	Associate	10851250, 12079514, 19018263, 22531638
Breast Neoplasms	Associate	10984506, 11044367, 11378386, 11668172, 12079514, 12379472, 15318936, 15569667, 17348446, 19061500, 19495794, 19644018, 21467033, 22301832, 23292282, 23372804, 23939428, 24338422, 24564733, 25119466, 26126114, 26549231, 26790955, 28739725, 29256014, 30224430, 30305115, 31141879, 31964465, 32028860, 32085795, 33380715, 33670444, 34756920, 35037412, 35079875, 35163433, 35406808, 36096037, 36114448, 36142452, 37747031, 39326102, 9660931
Breast Neoplasms	Inhibit	27556298
Breast Neoplasms	Stimulate	28427429
Bronchiectasis	Inhibit	30114278
Bronchiolitis Obliterans Syndrome	Associate	33758171
Burkitt Lymphoma	Associate	19018532
Burns	Associate	36012680
Calcinosis Cutis	Associate	23317272
Carcinogenesis	Associate	15274390, 15492468, 16854216, 18360708, 18372284, 22301832, 23317272, 23614038, 23939428, 24114184, 24631504, 25590353, 27499265, 28208577, 31821746, 33197888, 35449157, 36735267, 37873683
Carcinogenesis	Inhibit	30186819
Carcinoma	Associate	26429873
Carcinoma Hepatocellular	Associate	11401318, 11889080, 12412180, 12918101, 14563954, 14741344, 15294900, 15467764, 18407589, 19684609, 20044617, 23640460, 23703729, 25387077, 25836616, 27094504, 27483249, 29845188, 30250040, 31059053, 32638211, 33941198, 35449157
Carcinoma Hepatocellular	Inhibit	23212831
Carcinoma in Situ	Associate	18237383
Carcinoma in Situ	Stimulate	23114535
Carcinoma Non Small Cell Lung	Associate	15908479, 16835228, 20501643, 20668019, 22426809, 26331820, 28042952, 31027492, 31322235, 31993929, 33051435, 36286423, 37096255
Carcinoma Non Small Cell Lung	Inhibit	19139119, 19147542, 20234816, 24204697, 24925061
Carcinoma Non Small Cell Lung	Stimulate	22684020
Carcinoma Ovarian Epithelial	Associate	15583697, 17032502
Carcinoma Pancreatic Ductal	Associate	31311829
Carcinoma Papillary	Associate	15274390, 24798894
Carcinoma Papillary Follicular	Associate	25148236, 26649796, 29108474
Carcinoma Renal Cell	Associate	19252820, 23658787, 25122050, 26722456, 30699358
Carcinoma Squamous Cell	Associate	22426809, 24917395
Carcinoma Squamous Cell	Inhibit	36323682
Cardiomegaly	Associate	14675851
Cardiomyopathies	Associate	29622583, 39294340
Cardiomyopathy Dilated	Associate	39596228
Cardiomyopathy Hypertrophic	Inhibit	32455814
Cardiovascular Diseases	Associate	19228871, 19569080, 23389305, 23825649, 25923461, 35285386
Carotid Artery Diseases	Associate	21709632
Celiac Disease	Associate	27483138
Cell Transformation Neoplastic	Inhibit	25931782
Cell Transformation Neoplastic	Associate	27323819
Cerebral Infarction	Associate	19651920, 30697628
Charcot Marie Tooth Disease	Associate	28860329
Charcot Marie Tooth disease Type 1C	Associate	36902479
Chemical and Drug Induced Liver Injury	Associate	36675254
Cholestasis	Associate	35196362
Chondrosarcoma	Associate	11953889, 29573200
Chondrosarcoma Extraskeletal Myxoid	Associate	18855877
Chronic Disease	Associate	20164187, 23636469
Cognition Disorders	Associate	17052804, 18639367, 28181642, 29116943, 34762981
Cognitive Dysfunction	Associate	29116943
Colitis	Inhibit	22662201
Colitis	Associate	33820558
Colitis Ulcerative	Inhibit	19104705, 26462859
Colitis Ulcerative	Associate	21245992, 23256116, 24971461, 33299870, 36982725
Colonic Neoplasms	Associate	27499265, 27565680, 30595551
Colorectal Neoplasms	Associate	10076568, 10394368, 10851250, 11044367, 11378386, 11447213, 11950812, 12475986, 14521714, 14634802, 14662774, 15486348, 16108832, 16288226, 16854216, 16937502, 17143939, 17551074, 17565986, 17604322, 18203887, 18360708, 18992148, 19186181, 19283612, 19551868, 19912441, 21151932, 21765467, 22543585, 22761953, 24045924, 24338422, 24631504, 25098256, 25379721, 26130665, 27401066, 27428427, 27499265, 28504924, 29197895, 29740162, 29970681, 30186819, 30595551, 30931956, 30985693, 31244280, 32655010, 32813759, 34026331, 34889713, 34931923, 35738614, 37041476, 37530325, 37759783, 38177114
Colorectal Neoplasms	Stimulate	18195488, 24133572
Colorectal Neoplasms	Inhibit	18992148, 23583560, 24116229, 28878369, 34876290
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	24129064
Congenital Hypothyroidism	Associate	23436219
Constriction Pathologic	Associate	20334678
Coronary Aneurysm	Associate	21726861
Coronary Artery Disease	Associate	19228871, 20334678, 21206011, 21726861, 21889313, 25595457, 28415751, 31368668, 35866398
Coronary Artery Disease	Inhibit	21709632
Coronary Disease	Inhibit	19814730
Coronary Disease	Associate	26045830
Coronary Restenosis	Inhibit	20334678
Coronavirus Infections	Stimulate	28118607
COVID 19	Associate	34643000, 34931923, 37796681, 40016722
Crohn Disease	Associate	23256116
Crohn Disease	Inhibit	26462859
Cushing Syndrome	Associate	38098864
Cystic Fibrosis	Associate	18490773, 22860094
Cystic Fibrosis	Inhibit	30114278, 32537652
Cysts	Associate	20210794
Cytokine Release Syndrome	Inhibit	21843636
Cytomegalovirus Infections	Stimulate	27078877
Death	Associate	19228871
Delayed Emergence from Anesthesia	Associate	22179955
Dementia	Associate	18639367
Dental Plaque	Associate	23372645
Depressive Disorder	Associate	37747031
Dermatitis Atopic	Associate	33683743
Dermatomyositis	Associate	33766508
Diabetes Gestational	Inhibit	11832353
Diabetes Gestational	Associate	28133617, 28699988, 29385062, 31651513, 33551986
Diabetes Gestational	Stimulate	34912302
Diabetes Mellitus	Associate	12028454, 12096349, 12832613, 14729856, 15130939, 15143161, 15161789, 15543562, 15830179, 15976135, 15994875, 16316841, 16412238, 16538490, 16881538, 17052804, 17213274, 17496355, 17898990, 18076675, 18639367, 19125195, 19228871, 19436234, 19651920, 19806227, 20929593, 21765467, 22017455, 22056417, 22140563, 23006958, 23147557, 23389305, 23754948, 24447396, 26615044, 27150869, 28953253, 29464546, 30595551, 30931956, 31194872, 32816832, 33048460, 33551986, 33784687, 33831079, 34764936, 35422762, 36360783, 37993469, 38177114, 39420889, 9065481, 9425261, 9714568
Diabetes Mellitus	Stimulate	34026331, 34801581
Diabetes Mellitus Type 1	Associate	19455305, 26615044, 37338602
Diabetes Mellitus Type 2	Associate	10873398, 10984506, 12429071, 12663371, 14534304, 14981210, 15161789, 15543562, 15774022, 15784141, 15830179, 16007414, 17020404, 17213274, 17322631, 17463248, 17570749, 17825092, 18059616, 18498634, 18598350, 18639367, 18678618, 19125195, 19324937, 19346435, 19533082, 19720797, 19745552, 19846176, 19846795, 19862325, 19917066, 20142250, 20161779, 20334678, 20368233, 20424228, 20930717, 20977574, 21181894, 21206011, 21904299, 22017455, 22023374, 22174394, 22216000, 22569928, 22662265, 22791750, 22998375, 23147557, 23286787, 23386649, 23389305, 23559865, 24280871, 24427296, 24447396, 24929251, 25157153, 25368101, 25584717, 25889595, 25928419, 25954810, 25974167, 26105050, 26273662, 26606528, 26615044, 26975253, 27075119, 27424010, 27483138, 27749844, 28418876, 28699988, 29057944, 29256014, 29303622, 29703528, 29806605, 30064293, 30352878, 30827999, 31123324, 31188078, 31368668, 31912623, 31947684, 32041280, 32239932, 32455814, 33051435, 33784687, 33955199, 34243632, 34502231, 34764936, 35292917, 35334221, 35485096, 37047733, 37234928, 37993469, 38136661, 39217825, 9425261, 9449686
Diabetic Cardiomyopathies	Associate	34801581
Diabetic Nephropathies	Associate	15113752, 16291834, 19533082, 25889595, 27069916, 31912623, 34764936
Diabetic Neuropathies	Associate	21926103
Diabetic Retinopathy	Associate	19125195, 21501146, 23559865
Diabetic Retinopathy	Inhibit	39900481
Disease Resistance	Associate	15543562, 24032744
Down Syndrome	Associate	37792788
Drug Related Side Effects and Adverse Reactions	Associate	14563954, 18475308, 25098256, 35952447
Drug Related Side Effects and Adverse Reactions	Stimulate	22684020
Drug Resistant Epilepsy	Stimulate	37334286
Duane Retraction Syndrome	Associate	37781924
Dyslipidemias	Associate	20825652, 21533120, 24460649, 27075119
Ectodermal Dysplasia	Associate	37873683
Edema	Associate	20631015
Embolism Fat	Associate	30845774, 37107672
Endocrine System Diseases	Associate	26253174
Endometrial Neoplasms	Associate	33197888
Endometriosis	Associate	12620489, 15136115, 18571164, 23347089, 24064359, 35285386
Eosinophilic Esophagitis	Associate	32352681
Epidermal Cyst	Inhibit	33683743
Esophageal Neoplasms	Associate	15274302, 16805824, 27323819
Esophageal Squamous Cell Carcinoma	Associate	25220908
Fatty Liver	Inhibit	20168312
Fatty Liver	Associate	21155004, 24534255, 27034954, 30250040, 35422762, 36171144, 40065360
Fatty Liver Alcoholic	Associate	21155004
Fetal Growth Retardation	Associate	24307415, 26227476, 33729310
Fibrosis	Associate	21155004, 25132585, 27002005, 30250040, 32655010
Gardner Syndrome	Associate	27444220
Gastrointestinal Neoplasms	Associate	15507122
Gastrointestinal Neoplasms	Inhibit	18195488
Gestational Weight Gain	Associate	26930408
Glioblastoma	Associate	10851250, 15456533, 19018263, 26818439, 28642874, 33038582, 33652086
Glioma	Associate	12079514, 16319070, 22531638, 27122306, 28410531, 31652556, 32198386, 36067936
Glioma	Inhibit	19018263
Glomerulonephritis	Associate	15526907
Glomerulonephritis Membranous	Associate	35172688
Glomerulosclerosis Focal Segmental	Associate	22351778
Glucose Intolerance	Associate	17213274, 32455814
Glycosuria Renal	Associate	37338602
Granulosa cell tumor of the ovary	Associate	35922782
Graves Ophthalmopathy	Associate	14764816, 15886250, 32908802, 33488522
Graves Ophthalmopathy	Inhibit	31415657
Hearing Loss Noise Induced	Associate	25484013
Heart Diseases	Associate	14675851, 22606221, 32455814, 33907846
Heart Failure	Associate	16185925, 37950149
Helicobacter Infections	Associate	18372284, 25824760, 26225656, 33399167
Hemochromatosis	Associate	15245439
Hepatitis B	Associate	35037412
Hepatitis C	Associate	26735218
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
Histiocytosis Langerhans Cell	Associate	16968896
HIV Infections	Associate	23145084
HIV Infections	Inhibit	26735218, 28314381
HIV Infections	Stimulate	32849508
Hyperandrogenism	Associate	11591408, 21827375, 29630096
Hypercholesterolemia	Associate	23145084
Hyperglycemia	Inhibit	26010611
Hyperglycemia	Associate	31398873
Hyperinsulinism	Associate	11001753
Hyperlipidemia Familial Combined	Associate	18340007
Hyperlipidemias	Associate	35866398
Hyperlipoproteinemias	Associate	22023374
Hyperplasia	Associate	36901853
Hypertension	Associate	12096349, 17874829, 19569080, 19609054, 20623456, 20631015, 22023374, 26782582, 28827564, 29315078, 36947700, 37107672
Hypertension	Stimulate	29806605
Hypertension Pulmonary	Inhibit	25557278, 27432037
Hypertension Pulmonary	Associate	37792788
Hypertensive Retinopathy	Associate	28300834
Hypertriglyceridemia	Associate	16412238, 18424599, 29315078, 35422762
Hypertrophy	Associate	34186270
Hyperuricemia	Associate	23237621, 39796505
Hypoadiponectinemia	Associate	20168312, 27150869
Hypospadias	Associate	39236653
Hypoxia	Associate	17049073, 23455892, 28042952
Hypoxia	Inhibit	24307415, 25557278, 33907846, 37759548
Hypoxia	Stimulate	36230969
Hypoxia Brain	Inhibit	25557278
Hypoxia Brain	Associate	27432037, 30137220
Idiopathic Pulmonary Fibrosis	Associate	39313791
Immune System Diseases	Associate	28314381
Infections	Inhibit	20617179
Infections	Associate	26225656, 27078877
Infertility	Associate	24064359
Inflammation	Inhibit	10681562, 12594295, 15843495, 16311343, 17386086, 17425601, 18710415, 19114679, 19116451, 19569080, 19944411, 21911496, 22437669, 22455954, 22949934, 23566279, 23962407, 24368768, 25116714, 30044769, 33297574, 33858751, 37259630, 38041147, 39684781, 40334825
Inflammation	Associate	11287611, 11378386, 15113752, 15130939, 15492468, 15526907, 16271155, 16443643, 16937502, 17237310, 17681149, 18195488, 18372284, 18490773, 18927280, 18992148, 19018532, 19104705, 19186181, 19217272, 19228871, 19286977, 19455305, 19689798, 19814730, 20164187, 20205597, 20334678, 20713685, 21155004, 21252350, 21501146, 21525510, 21533120, 21700710, 21726861, 21765445, 22124178, 22174394, 22606221, 22761953, 23256116, 23372804, 23636469, 23770053, 23776688, 24971461, 24976683, 26130665, 26718495, 26985901, 27703009, 28420166, 29256014, 30114278, 30118830, 30224430, 30697628, 30931956, 31506535, 31554889, 31612365, 31752240, 33907846, 34490481, 34680073, 35436029, 35684465, 35946453, 36498897, 36542958, 36726689, 36768382, 36768617, 36902479, 37047733, 37096255, 39561439, 39905475, 9748221
Inflammatory Bowel Diseases	Associate	19104705, 20362587, 21245992, 24971461, 34075172, 39684781
Inflammatory Bowel Diseases	Stimulate	36364889
Influenza Human	Associate	24360890
Insulin Resistance	Associate	11001753, 11924722, 14729856, 14981210, 15543562, 15784141, 16316841, 16412238, 16785159, 17011503, 17135601, 17141766, 17322631, 17986714, 18362424, 18776171, 19689798, 19745552, 19841271, 19966034, 20045799, 20368233, 20930717, 21443859, 21479595, 22102511, 22694222, 22791750, 22998375, 23145084, 23748472, 24447396, 24719315, 24759262, 25157153, 25274455, 25584717, 26615044, 27075119, 28208577, 28225792, 29256014, 30639037, 31194872, 33831079, 34186270, 34764936, 35422762, 37049846, 9425261
Insulin Resistance	Inhibit	19816416, 20168312, 32455814, 9449686
Insulin Resistance	Stimulate	33843164
Intervertebral Disc Degeneration	Associate	36972403, 37266623, 38041147
Intestinal Diseases	Associate	33048460
Intrahepatic Cholestasis of Pregnancy	Stimulate	24489901
Irritable Bowel Syndrome	Stimulate	30186819
Ischemia	Inhibit	36082081
Ischemic Attack Transient	Associate	21709632
Keloid	Associate	24250248
Keratoconus	Associate	32165822
Kidney Diseases	Associate	16291834, 22949934, 25122050, 25889595, 35946453, 37338602
Kidney Failure Chronic	Associate	25784779, 26881045
Leigh Disease	Associate	27080638
Leiomyoma	Associate	34224241
Leprosy	Stimulate	31371410
Leprosy Tuberculoid	Associate	36982725
Leukemia	Associate	12691917, 28978268
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28154092, 31371410
Leukemia Myeloid	Associate	15642706, 20501850, 28978268
Leukemia Myeloid Acute	Associate	15642706, 20501850, 34502231, 34549887
Leukemia Promyelocytic Acute	Associate	10681562
Leydig Cell Tumor	Inhibit	32180008
Lipedema	Stimulate	32059474
Lipid Metabolism Disorders	Associate	20623456, 32955223
Lipodystrophy	Associate	18076675, 21479595, 25157153, 27749844, 28208577, 34764936, 36402763
Lipodystrophy Familial Partial	Associate	16412238, 18076675, 21479595, 22989829, 28300834, 29622583, 30595551, 31000363, 31194872, 34168618, 35422762, 36171144, 38231342, 39420889, 39596129
Lipoma	Associate	19772889
Liposarcoma	Associate	10097144, 10984506, 21598240, 25650275, 26193637, 27401457, 8990192
Liposarcoma Myxoid	Associate	27401457
Liver Cirrhosis	Associate	17010940, 25159899, 27002005, 37059745
Liver Cirrhosis Alcoholic	Associate	27002005
Liver Diseases	Associate	40065360
Liver Failure	Associate	23891824, 30250040, 35422762
Lung Diseases	Associate	22426809, 22924744, 37792788
Lung Neoplasms	Associate	15908479, 17172826, 22426809, 26244663, 26863638, 28460464, 31993929, 33414372, 36364935
Lupus Erythematosus Systemic	Associate	23962407
Lupus Erythematosus Systemic	Stimulate	33584646
Lymphatic Metastasis	Stimulate	15274390
Lymphatic Metastasis	Associate	26722456
Lymphoma B Cell	Associate	17015690, 19018532
Lymphoma Large Cell Anaplastic	Associate	30206415
Malformations of Cortical Development Group I	Associate	16766531
Medulloblastoma	Associate	18546270
Meibomian Gland Dysfunction	Associate	21482872
Melanoma	Associate	12230498, 17352234, 18537861, 23049949
MELAS Syndrome	Associate	32244971
Mental Disorders	Associate	16470700
Metabolic Diseases	Associate	17259396, 18777501, 22140563, 22426809, 23237621, 23636469, 24040456, 25159899, 25931782, 27773974, 29622583, 30639037, 32955223, 33729310, 37047733, 37108582
Metabolic Syndrome	Associate	18198294, 18362424, 18424599, 19639232, 19745552, 19806227, 20930717, 21289232, 21833030, 21918574, 21949049, 23145084, 23437214, 24200052, 25159899, 25366759, 26125830, 26673968, 29057944, 29315078, 30607268, 31188078, 32239932, 34186270, 35422762, 37761915
Microphthalmia syndromic 7	Associate	27401457
Mitochondrial Diseases	Associate	25122050, 27366949, 30231525
Mitochondrial Myopathy with Diabetes	Associate	27150869
Mouth Diseases	Associate	19683227
Mouth Neoplasms	Associate	32519370
Multiple Myeloma	Associate	14975242, 18927280, 39769169
Multiple Myeloma	Inhibit	17785586
Multiple Organ Failure	Associate	27023591
Multiple Sclerosis	Associate	20164187
Multiple Sclerosis	Inhibit	33297574
Myocardial Infarction	Associate	12663371, 16881538, 17921408, 19228871, 22525341, 22653647, 35757636
Myocardial Ischemia	Associate	19228871
Myocarditis	Associate	39905475
Myotonic Dystrophy	Associate	20930717, 25784779, 32816832, 34764936
Myotonic Dystrophy	Stimulate	30845774
Myotonic Dystrophy	Inhibit	32816832
Nasal Polyps	Inhibit	16271155
Nasal Polyps	Associate	31839751
Necrosis	Stimulate	15946122
Neoplasm Invasiveness	Inhibit	27483249
Neoplasm Invasiveness	Associate	31027492
Neoplasm Metastasis	Inhibit	12006550, 33289586
Neoplasm Metastasis	Associate	12230498, 17551074, 23292282, 23317272, 24603556, 35850179, 35922782, 36364935, 37478577
Neoplasm Metastasis	Stimulate	27401457
Neoplasms	Associate	10097144, 10394368, 10851250, 10935488, 11278336, 11378386, 11401318, 11889080, 11940602, 12079514, 12454768, 12651598, 14741344, 15037811, 15143161, 15238980, 15274390, 15492468, 15533890, 15799828, 16527820, 16698954, 16805824, 17597617, 18195488, 18537861, 18855877, 19061500, 19186181, 19289465, 19436234, 19495794, 19644018, 19818126, 19893615, 20044617, 20191040, 20372080, 20526288, 20564403, 21151932, 21251908, 21765467, 22053058, 22067385, 22426809, 22761953, 23114535, 23206928, 23212831, 23436219, 23583560, 23605322, 24032744, 24603556, 24631504, 24716976, 24875049, 25119466, 25578962, 25590353, 25824760, 25931782, 26429873, 26722456, 26790955, 26818439, 26988609, 26999671, 27197067, 27283500, 27401457, 27428427, 28122331, 28208577, 28617309, 28642874, 28978268, 29573196, 29845188, 30651555, 30931956, 31027492, 31322235, 31993929, 32519370, 33051435, 33197888, 33289586, 33414372, 34026331, 34243632, 34534729, 34549887, 34563222, 34645125, 35406808, 35738614, 35922782, 36067936, 36120427, 36587194, 36710483, 37530325, 38177114, 9714568
Neoplasms	Inhibit	11287611, 12230498, 12412180, 12495476, 20210794, 23049949, 24129064, 24133572, 24204697, 27401066, 27483249, 30474469, 37096255
Neoplasms	Stimulate	16854216, 28427429
Neoplasms Adipose Tissue	Associate	16007414, 16421345, 17903300, 18379566, 19846795, 20045799, 26185753, 30652031, 32655010, 34186270, 9790929
Neoplasms Glandular and Epithelial	Associate	10935488
Neoplasms Radiation Induced	Associate	33986314
Nerve Degeneration	Associate	21605119, 35684047
Neuroblastoma	Associate	12079514, 15171682, 16969347, 19939254, 20564403, 35531888, 37918553
Neurotoxicity Syndromes	Associate	33986314
Neutrophilia Hereditary	Associate	22860094
Nevus Pigmented	Associate	12230498, 18537861
Non alcoholic Fatty Liver Disease	Associate	20825652, 21155004, 22820754, 23891824, 32505733, 34459761, 35654975, 37861538, 39174891
Non Muscle Invasive Bladder Neoplasms	Associate	24525232
Nonsyndromic Holoprosencephaly	Associate	27494611
Nose Diseases	Inhibit	16271155
Obesity	Associate	10873398, 11001753, 11591408, 11832353, 12429071, 14981210, 15533890, 15784141, 15830179, 15976135, 16007414, 16210701, 16421345, 16470700, 17052804, 17616777, 17653445, 17874829, 17898990, 18379566, 18388889, 18498634, 18657264, 18777501, 19351711, 19491387, 19816416, 19818126, 19846176, 19966034, 20054173, 20168312, 20814411, 21357378, 21448362, 21479595, 21508507, 21833030, 22023374, 22056417, 22102511, 22513296, 22653647, 22694222, 23237621, 23389305, 23545576, 23566279, 24200052, 24427296, 24759262, 24827746, 25224558, 25589532, 25595457, 25923461, 25928419, 26185753, 26273662, 26673968, 26912161, 27030533, 27442659, 27515755, 27664422, 27773974, 28090739, 28878369, 29256014, 29335416, 29679223, 30652031, 30931956, 31044373, 32455814, 32505733, 33729310, 33831079, 34459761, 34764936, 35292917, 36466447, 37047733, 37107672, 37742414, 37761915, 37800791, 39174891, 39457458, 9153284, 9425261, 9449686, 9750197
Obesity	Inhibit	22797373, 28320058, 29065800
Obesity	Stimulate	28541534, 30845774, 34762981, 35397570
Obesity Maternal	Associate	24307415
Obesity Morbid	Associate	21904299
Obesity Morbid	Stimulate	29335416
Osteoarthritis	Associate	11840453, 21245597, 22455954, 23776688, 23884832, 35023382, 35288246
Osteoarthritis	Inhibit	17386086, 24976683
Osteoarthritis	Stimulate	18302252
Osteoarthritis Knee	Associate	16973789, 21245597, 39809203
Osteogenesis imperfecta type 3	Associate	39596129
Osteoglophonic dwarfism	Inhibit	30347434
Osteonecrosis	Associate	31135556
Osteosarcoma	Associate	12006550, 36438897, 38217543
Osteosarcoma	Stimulate	35922782
Ovarian Diseases	Associate	15266333
Ovarian Neoplasms	Associate	15266333, 16698954, 17032502, 21283708, 23200915, 25659662
Ovarian Neoplasms	Stimulate	15583697
Overweight	Associate	22023374, 25589532, 25923461, 27773974, 32455814
Pain	Associate	19683227, 24064359, 35023382
Pancreatic Neoplasms	Associate	15479693, 15754392, 19436234, 21357378, 25516658, 37857015
Pancreatic Neoplasms	Inhibit	16547153
Pancreatitis	Associate	16412238
Parkinson Disease	Associate	27366949
Penile Neoplasms	Associate	28122331, 28751665
Peptic Ulcer	Associate	18372284, 33399167
Periodontitis	Associate	37047733
Peripheral Nervous System Diseases	Associate	35422762, 36741233
Phenylketonurias	Associate	16199543
Placenta Diseases	Associate	37702083
Plaque Atherosclerotic	Associate	11861426, 21350215, 9748221
Pneumonia	Inhibit	19217272
Pneumonia	Associate	21148223
Polycystic Kidney Autosomal Dominant	Associate	20210794, 22174924
Polycystic Ovary Syndrome	Associate	16316841, 16785159, 21827375, 23748472, 24040456, 26975253, 28949260, 29630096, 33228780
Pre Eclampsia	Associate	28933788, 37702083
Precancerous Conditions	Associate	22426809
Precancerous Conditions	Stimulate	26244663
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16403907
Preeclamptic toxemia	Inhibit	28933788, 37702083
Premature Birth	Associate	17259396
Primary Ovarian Insufficiency	Associate	40696610
Prostatic Neoplasms	Associate	10984506, 11044367, 18475308, 19528499, 20466759, 20932825, 21525782, 26788504, 26945682, 28800317, 33031638, 33780364, 38428827, 39273616
Prostatic Neoplasms	Inhibit	21613824, 25931782
Prostatic Neoplasms	Stimulate	37171501
Prostatitis	Associate	16519808
Pruritus	Associate	33766508
Pseudomonas Infections	Inhibit	22860094
Psoriasis	Associate	33683743
Pulmonary Arterial Hypertension	Associate	25986483, 30081553, 30699358, 33907846, 34989130, 36947700, 37792788
Pulmonary Disease Chronic Obstructive	Associate	21044285, 24368768, 30118830, 35436029, 38059012
Pulmonary Fibrosis	Associate	20205597, 33422967
Rectal Neoplasms	Associate	29970681, 35738614
Renal Insufficiency	Associate	36901853
Renal Insufficiency Chronic	Associate	16291834
Respiratory Syncytial Virus Infections	Associate	17425601
Respiratory Tract Diseases	Associate	12594295
Retinal Diseases	Associate	28300834
Ring Chromosome 20 Syndrome	Inhibit	30347434
Rupture	Associate	36303246
Sarcoma Ewing	Stimulate	35922782
Schizophrenia	Associate	25433960
Scleroderma Systemic	Associate	25986483
Sclerosis	Associate	12028454
Sebaceous Gland Neoplasms	Associate	36735267
Sepsis	Associate	27023591
Simpson Golabi Behmel syndrome	Associate	22998375, 30967578
Skin Diseases	Inhibit	33584646
Skin Diseases	Associate	34243632
Sleep Apnea Obstructive	Associate	21508507, 25660813, 31044373
Sleep Initiation and Maintenance Disorders	Associate	16210701
Smoke Inhalation Injury	Associate	30044769, 36012680
Soft Tissue Injuries	Associate	21605119, 22018099
Solitary Fibrous Tumors	Stimulate	33887215
Spondylitis Ankylosing	Associate	39692554
Squamous Cell Carcinoma of Head and Neck	Associate	12454768
Stomach Diseases	Inhibit	14759512
Stomach Neoplasms	Associate	10428487, 11044367, 12149143, 12824901, 14562367, 15492468, 18372284, 19140230, 23317272, 23605322, 23907334, 25590353, 25824760, 26225656, 29417935, 30880766, 33760104, 36587194
Stomach Neoplasms	Inhibit	36587194
Stroke	Associate	21709632
Supranuclear Palsy Progressive	Inhibit	29096320
Tendinopathy	Associate	29385715
Thinness	Associate	35110547
Thrombosis	Associate	15130939
Thyroid cancer follicular	Associate	12651598, 15256783, 20056739, 33009242
Thyroid Cancer Papillary	Inhibit	15238980
Thyroid Cancer Papillary	Associate	15274390, 23025542, 23436219, 24327398, 24798894, 26649796, 27494611, 34645125, 35292786, 35397361
Thyroid Carcinoma Anaplastic	Associate	12495476, 25742642, 29924913
Thyroid Hormone Metabolism Abnormal	Associate	27920511
Thyroid Neoplasms	Associate	12651598, 15238980, 23436219, 24114184, 24510380, 24798894, 26258321, 26259532, 26695504, 29373711, 34167437, 35292786, 35397361, 38277563, 39187346
Thyroid Neoplasms	Inhibit	33009242
Thyroid Nodule	Associate	24798894, 33860907
Thyroiditis	Associate	29469940, 39187346
Triple Negative Breast Neoplasms	Associate	33650675, 37478577
Triple Negative Breast Neoplasms	Inhibit	36114448, 40604951
Tuberculosis Multidrug Resistant	Associate	24032744, 28978268
Ulcer	Associate	20191040
Urethral Neoplasms	Associate	33289586
Urethritis	Associate	11485917
Urinary Bladder Neoplasms	Associate	10935488, 23114535, 27699256, 33537076, 35850179, 36131343, 36323682, 36542958, 37800791, 38129585
Urinary Bladder Neoplasms	Stimulate	30651555
Urinary Retention	Stimulate	20631015
Uterine Cervical Neoplasms	Associate	24642720, 24716976, 25563418, 40446016
Uveal melanoma	Associate	23206928
Vascular Diseases	Associate	11717164, 12457461, 14572662, 15130939
Vascular Ring	Associate	35712246
Vascular System Injuries	Associate	34369277
Ventricular Remodeling	Associate	14718259
Vitiligo	Associate	36429011
Weight Gain	Associate	17898990
Weight Loss	Associate	17898990, 19543210, 22102511, 22179955, 28578327, 35292917, 9153284
Wounds and Injuries	Associate	19104705, 27023591, 36012680, 39617505
Xerostomia	Associate	29960292