Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5467
Gene name Gene Name - the full gene name approved by the HGNC.	Peroxisome proliferator activated receptor delta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PPARD
Synonyms (NCBI Gene) Gene synonyms aliases	FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcr

Show/Hide all(268)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049777	hsa-miR-92a-3p	CLASH	23622248
MIRT043275	hsa-miR-331-3p	CLASH	23622248
MIRT053749	hsa-miR-29b-3p	Microarray	22942087
MIRT439926	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439926	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1251745	hsa-miR-106a	CLIP-seq
MIRT1251746	hsa-miR-106b	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT1251748	hsa-miR-1266	CLIP-seq
MIRT1251749	hsa-miR-1321	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT1251753	hsa-miR-17	CLIP-seq
MIRT1251754	hsa-miR-20a	CLIP-seq
MIRT1251755	hsa-miR-20b	CLIP-seq
MIRT1251756	hsa-miR-3202	CLIP-seq
MIRT1251757	hsa-miR-34a	CLIP-seq
MIRT1251758	hsa-miR-34c-5p	CLIP-seq
MIRT1251759	hsa-miR-3609	CLIP-seq
MIRT1251760	hsa-miR-3665	CLIP-seq
MIRT1251761	hsa-miR-3689d	CLIP-seq
MIRT1251762	hsa-miR-4270	CLIP-seq
MIRT1251763	hsa-miR-4441	CLIP-seq
MIRT1251764	hsa-miR-449a	CLIP-seq
MIRT1251765	hsa-miR-449b	CLIP-seq
MIRT1251766	hsa-miR-4518	CLIP-seq
MIRT1251767	hsa-miR-4728-5p	CLIP-seq
MIRT1251768	hsa-miR-4730	CLIP-seq
MIRT1251769	hsa-miR-4739	CLIP-seq
MIRT1251770	hsa-miR-4747-5p	CLIP-seq
MIRT1251771	hsa-miR-4756-5p	CLIP-seq
MIRT1251772	hsa-miR-4796-3p	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT1251774	hsa-miR-512-3p	CLIP-seq
MIRT1251775	hsa-miR-519d	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT1251777	hsa-miR-548ah	CLIP-seq
MIRT1251778	hsa-miR-596	CLIP-seq
MIRT1251779	hsa-miR-657	CLIP-seq
MIRT1251780	hsa-miR-93	CLIP-seq
MIRT1251745	hsa-miR-106a	CLIP-seq
MIRT1251746	hsa-miR-106b	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT1251781	hsa-miR-1262	CLIP-seq
MIRT1251782	hsa-miR-1287	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT1251753	hsa-miR-17	CLIP-seq
MIRT1251754	hsa-miR-20a	CLIP-seq
MIRT1251755	hsa-miR-20b	CLIP-seq
MIRT1251784	hsa-miR-2115	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT1251787	hsa-miR-3194-3p	CLIP-seq
MIRT1251788	hsa-miR-3195	CLIP-seq
MIRT1251759	hsa-miR-3609	CLIP-seq
MIRT1251789	hsa-miR-3622b-5p	CLIP-seq
MIRT1251760	hsa-miR-3665	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT1251793	hsa-miR-4691-5p	CLIP-seq
MIRT1251794	hsa-miR-4701-3p	CLIP-seq
MIRT1251772	hsa-miR-4796-3p	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT1251795	hsa-miR-516a-3p	CLIP-seq
MIRT1251775	hsa-miR-519d	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT1251777	hsa-miR-548ah	CLIP-seq
MIRT1251778	hsa-miR-596	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT1251779	hsa-miR-657	CLIP-seq
MIRT1251797	hsa-miR-760	CLIP-seq
MIRT1251780	hsa-miR-93	CLIP-seq
MIRT1251798	hsa-miR-1182	CLIP-seq
MIRT1251799	hsa-miR-122	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251800	hsa-miR-3166	CLIP-seq
MIRT1251801	hsa-miR-3615	CLIP-seq
MIRT1251802	hsa-miR-3652	CLIP-seq
MIRT1251803	hsa-miR-3664-5p	CLIP-seq
MIRT1251804	hsa-miR-3692	CLIP-seq
MIRT1251805	hsa-miR-4430	CLIP-seq
MIRT1251806	hsa-miR-4639-3p	CLIP-seq
MIRT1251807	hsa-miR-4771	CLIP-seq
MIRT1251808	hsa-miR-498	CLIP-seq
MIRT1251809	hsa-miR-541	CLIP-seq
MIRT1251810	hsa-miR-654-5p	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT2074245	hsa-miR-4251	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT2301234	hsa-miR-1193	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2301238	hsa-miR-24	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301241	hsa-miR-3192	CLIP-seq
MIRT2301242	hsa-miR-3607-5p	CLIP-seq
MIRT2301243	hsa-miR-3616-3p	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT1251762	hsa-miR-4270	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301246	hsa-miR-4300	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT1251763	hsa-miR-4441	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT2301250	hsa-miR-561	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT2301253	hsa-miR-9	CLIP-seq
MIRT2301254	hsa-miR-920	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT2392866	hsa-miR-4704-5p	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT2392867	hsa-miR-4763-5p	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT2597830	hsa-miR-1178	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2597831	hsa-miR-1224-3p	CLIP-seq
MIRT2597832	hsa-miR-1229	CLIP-seq
MIRT2597833	hsa-miR-1237	CLIP-seq
MIRT2597834	hsa-miR-1248	CLIP-seq
MIRT2597835	hsa-miR-1254	CLIP-seq
MIRT1251781	hsa-miR-1262	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT2597836	hsa-miR-1286	CLIP-seq
MIRT2597837	hsa-miR-1291	CLIP-seq
MIRT2597838	hsa-miR-1294	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2597839	hsa-miR-1913	CLIP-seq
MIRT1251784	hsa-miR-2115	CLIP-seq
MIRT2597840	hsa-miR-218	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT2597841	hsa-miR-3065-5p	CLIP-seq
MIRT2597842	hsa-miR-3116	CLIP-seq
MIRT2597843	hsa-miR-3127-5p	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT2597844	hsa-miR-3136-3p	CLIP-seq
MIRT2597845	hsa-miR-3173-5p	CLIP-seq
MIRT2597846	hsa-miR-3176	CLIP-seq
MIRT2597847	hsa-miR-3183	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301241	hsa-miR-3192	CLIP-seq
MIRT1251787	hsa-miR-3194-3p	CLIP-seq
MIRT2597848	hsa-miR-3194-5p	CLIP-seq
MIRT1251788	hsa-miR-3195	CLIP-seq
MIRT2597849	hsa-miR-320e	CLIP-seq
MIRT2597850	hsa-miR-324-3p	CLIP-seq
MIRT2597851	hsa-miR-326	CLIP-seq
MIRT2597852	hsa-miR-328	CLIP-seq
MIRT2597853	hsa-miR-330-5p	CLIP-seq
MIRT2597854	hsa-miR-339-3p	CLIP-seq
MIRT1251757	hsa-miR-34a	CLIP-seq
MIRT1251758	hsa-miR-34c-5p	CLIP-seq
MIRT2301243	hsa-miR-3616-3p	CLIP-seq
MIRT2597855	hsa-miR-3622a-3p	CLIP-seq
MIRT2597856	hsa-miR-3622b-3p	CLIP-seq
MIRT1251789	hsa-miR-3622b-5p	CLIP-seq
MIRT2597857	hsa-miR-3661	CLIP-seq
MIRT2597858	hsa-miR-3672	CLIP-seq
MIRT2597859	hsa-miR-3921	CLIP-seq
MIRT2597860	hsa-miR-3922-3p	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT2597861	hsa-miR-4254	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT2597862	hsa-miR-4268	CLIP-seq
MIRT2597863	hsa-miR-4287	CLIP-seq
MIRT2597864	hsa-miR-4292	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301246	hsa-miR-4300	CLIP-seq
MIRT2597865	hsa-miR-4308	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT2597866	hsa-miR-4419a	CLIP-seq
MIRT2597867	hsa-miR-4436b-3p	CLIP-seq
MIRT2597868	hsa-miR-4447	CLIP-seq
MIRT2597869	hsa-miR-4448	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT2597870	hsa-miR-4469	CLIP-seq
MIRT2597871	hsa-miR-4472	CLIP-seq
MIRT2597872	hsa-miR-4488	CLIP-seq
MIRT2597873	hsa-miR-4493	CLIP-seq
MIRT1251764	hsa-miR-449a	CLIP-seq
MIRT1251765	hsa-miR-449b	CLIP-seq
MIRT2597874	hsa-miR-4510	CLIP-seq
MIRT2597875	hsa-miR-4649-3p	CLIP-seq
MIRT2597876	hsa-miR-4650-5p	CLIP-seq
MIRT2597877	hsa-miR-4653-5p	CLIP-seq
MIRT2597878	hsa-miR-4667-3p	CLIP-seq
MIRT2597879	hsa-miR-4685-3p	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT1251793	hsa-miR-4691-5p	CLIP-seq
MIRT2597880	hsa-miR-4693-3p	CLIP-seq
MIRT2597881	hsa-miR-4697-5p	CLIP-seq
MIRT1251794	hsa-miR-4701-3p	CLIP-seq
MIRT2597882	hsa-miR-4707-5p	CLIP-seq
MIRT2597883	hsa-miR-4714-3p	CLIP-seq
MIRT2597884	hsa-miR-4716-3p	CLIP-seq
MIRT2597885	hsa-miR-4721	CLIP-seq
MIRT2597886	hsa-miR-4722-5p	CLIP-seq
MIRT2597887	hsa-miR-4723-3p	CLIP-seq
MIRT2597888	hsa-miR-4723-5p	CLIP-seq
MIRT1251767	hsa-miR-4728-5p	CLIP-seq
MIRT1251768	hsa-miR-4730	CLIP-seq
MIRT2597889	hsa-miR-4733-3p	CLIP-seq
MIRT2597890	hsa-miR-4749-3p	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT2392867	hsa-miR-4763-5p	CLIP-seq
MIRT2597891	hsa-miR-4792	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT2597892	hsa-miR-490-3p	CLIP-seq
MIRT2597893	hsa-miR-492	CLIP-seq
MIRT2597894	hsa-miR-508-5p	CLIP-seq
MIRT1251774	hsa-miR-512-3p	CLIP-seq
MIRT1251795	hsa-miR-516a-3p	CLIP-seq
MIRT2597895	hsa-miR-539	CLIP-seq
MIRT2597896	hsa-miR-583	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2597897	hsa-miR-619	CLIP-seq
MIRT2597898	hsa-miR-631	CLIP-seq
MIRT2597899	hsa-miR-636	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT1251797	hsa-miR-760	CLIP-seq
MIRT2597900	hsa-miR-766	CLIP-seq
MIRT2597901	hsa-miR-767-3p	CLIP-seq
MIRT2597902	hsa-miR-769-5p	CLIP-seq
MIRT2301254	hsa-miR-920	CLIP-seq
MIRT2597903	hsa-miR-942	CLIP-seq
MIRT1251799	hsa-miR-122	CLIP-seq
MIRT2688402	hsa-miR-1290	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251802	hsa-miR-3652	CLIP-seq
MIRT1251805	hsa-miR-4430	CLIP-seq
MIRT2688403	hsa-miR-4654	CLIP-seq
MIRT2688404	hsa-miR-4769-5p	CLIP-seq
MIRT1251809	hsa-miR-541	CLIP-seq
MIRT1251810	hsa-miR-654-5p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465
JUN	Activation	18625220
RELA	Repression	14708613

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001103	Function	RNA polymerase II repressing transcription factor binding	IBA	21873635
GO:0001223	Function	Transcription coactivator binding	IPI	15001550
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12955147, 15001550
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11551955
GO:0003707	Function	Steroid hormone receptor activity	TAS	1333051
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0004879	Function	Nuclear receptor activity	IDA	12955147
GO:0005515	Function	Protein binding	IPI	15722453, 23455924
GO:0005634	Component	Nucleus	NAS	11551955
GO:0005654	Component	Nucleoplasm	TAS
GO:0006006	Process	Glucose metabolic process	NAS	15793256
GO:0006029	Process	Proteoglycan metabolic process	IEA
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	1333051
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1333051
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006629	Process	Lipid metabolic process	ISS
GO:0006631	Process	Fatty acid metabolic process	IBA	21873635
GO:0006635	Process	Fatty acid beta-oxidation	ISS
GO:0006635	Process	Fatty acid beta-oxidation	TAS	15192438, 15803109
GO:0006776	Process	Vitamin A metabolic process	IEA
GO:0006915	Process	Apoptotic process	IMP	12909723
GO:0007507	Process	Heart development	IEA
GO:0007566	Process	Embryo implantation	TAS	11551955
GO:0008134	Function	Transcription factor binding	IPI	26504087
GO:0008144	Function	Drug binding	IDA	10198642
GO:0008203	Process	Cholesterol metabolic process	TAS	15192438
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	ISS
GO:0008289	Function	Lipid binding	IDA	12955147
GO:0008366	Process	Axon ensheathment	ISS
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0009062	Process	Fatty acid catabolic process	TAS	15192438
GO:0009749	Process	Response to glucose	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA	21873635
GO:0010887	Process	Negative regulation of cholesterol storage	IBA	21873635
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IEA
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IEA
GO:0015908	Process	Fatty acid transport	ISS
GO:0019216	Process	Regulation of lipid metabolic process	IBA	21873635
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0033993	Process	Response to lipid	IBA	21873635
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042060	Process	Wound healing	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043401	Process	Steroid hormone mediated signaling pathway	IEA
GO:0043415	Process	Positive regulation of skeletal muscle tissue regeneration	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	NAS	10991946
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045684	Process	Positive regulation of epidermis development	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12955147
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046321	Process	Positive regulation of fatty acid oxidation	IEA
GO:0046697	Process	Decidualization	TAS	11551955
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA	21873635
GO:0051059	Function	NF-kappaB binding	IEA
GO:0051546	Process	Keratinocyte migration	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0070539	Function	Linoleic acid binding	IDA	10198642
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0097190	Process	Apoptotic signaling pathway	IMP	11551955
GO:1902894	Process	Negative regulation of pri-miRNA transcription by RNA polymerase II	ISS
GO:1904659	Process	Glucose transmembrane transport	NAS	15793256
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA

MIM	HGNC	e!Ensembl
600409	9235	ENSG00000112033

Protein

UniProt ID

Q03181

Protein name

Peroxisome proliferator-activated receptor delta (PPAR-delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator-activated receptor beta) (PPAR-beta)

Protein function

Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues (PubMed:35675826). Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty a

PDB

1GWX , 1Y0S , 2AWH , 2B50 , 2BAW , 2ENV , 2GWX , 2J14 , 2Q5G , 2XYJ , 2XYW , 2XYX , 2ZNP , 2ZNQ , 3D5F , 3DY6 , 3ET2 , 3GWX , 3GZ9 , 3OZ0 , 3PEQ , 3SP9 , 3TKM , 5U3Q , 5U3R , 5U3S , 5U3T , 5U3U , 5U3V , 5U3W , 5U3X , 5U3Y , 5U3Z , 5U40 , 5U41 , 5U42 , 5U43 , 5U44 , 5U45 , 5U46 , 5XMX , 5Y7X , 5ZXI , 6A6P , 7F80 , 7VWE , 7VWF , 7VWG , 7VWH , 7W0G , 7WGL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	72 → 140	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	236 → 422	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with maximal levels in placenta and skeletal muscle.

Sequence

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY

Sequence length

441

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Efferocytosis Wnt signaling pathway Pathways in cancer Acute myeloid leukemia		Carnitine metabolism Regulation of pyruvate dehydrogenase (PDH) complex Nuclear Receptor transcription pathway Signaling by Retinoic Acid

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Cardiomyopathy	Cardiomyopathies, Primary, Cardiomyopathies	rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377 View all (900 more)	20075336
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	28962521
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20176998, 16168052

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Gout	Gout	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (101)

Disease Name	Relationship Type	References
Associations from Text Mining
Abidi X linked mental retardation syndrome	Associate	28737528
Acidosis	Inhibit	32900990
Adenocarcinoma of Lung	Associate	33637678
Adenomatous Polyposis Coli	Associate	11226285
Adenomatous Polyps	Stimulate	16969348
Alzheimer Disease	Associate	31884472
Anophthalmia with pulmonary hypoplasia	Associate	26578390
Anorchia	Inhibit	26431381
Astrocytoma	Associate	32198386
Atherosclerosis	Associate	20645257, 28128413
Bipolar Disorder	Associate	18606951
Brain Injuries Traumatic	Associate	37418975
Breast Neoplasms	Associate	18054822, 23375374, 32238697
Bulbo Spinal Atrophy X Linked	Stimulate	28005993
Burns	Associate	19639232
Carcinogenesis	Associate	10555149, 11226285, 11228540, 16969348, 18054822, 18566335, 20424164, 23049921, 23208498, 23832539, 34921177
Carcinoma Hepatocellular	Associate	33941198, 35151320, 36396671
Carcinoma Non Small Cell Lung	Associate	16061473, 18390835, 18566335, 18776129, 19654299
Carcinoma Non Small Cell Lung	Stimulate	23049921
Carcinoma Non Small Cell Lung	Inhibit	34921177
Cholangiocarcinoma	Associate	16966336
Colorectal Neoplasms	Associate	10555149, 11226285, 16288226, 16969348, 19283612, 21765467, 23086933, 23832539, 24391853, 28128413, 30985693
Colorectal Neoplasms	Stimulate	17767717
Coronary Artery Disease	Associate	20645257, 26871769, 30429241, 31340238
Coronary Disease	Associate	14641801
Cytokine Release Syndrome	Inhibit	21843636
Dermatitis Atopic	Associate	33683743
Diabetes Gestational	Associate	23323702
Diabetes Mellitus	Associate	16538490, 16966336, 18054822
Diabetes Mellitus Type 2	Associate	22509365, 24359475, 25061733, 27655316, 28128413, 29776318, 34772419, 36051387, 38136661
Diabetic Retinopathy	Associate	26015769
Digestive System Neoplasms	Associate	25043640
Disease	Associate	23874790
Drug Related Side Effects and Adverse Reactions	Associate	37946254
Dyslipidemias	Associate	32664384
Endometrial Neoplasms	Associate	11228540, 23943160
Epidermal Cyst	Associate	33683743
Fatty Liver	Associate	31839747
Fibrosis	Inhibit	37175437
Gallbladder Neoplasms	Associate	18497548
Glioma	Associate	32198386
Glucose Intolerance	Stimulate	19504086
Glucose Metabolism Disorders	Associate	29776318
Hearing Loss Noise Induced	Associate	25484013
Heart Diseases	Associate	22606221
Hidradenitis Suppurativa	Associate	32078194
Hyperglycemia	Associate	32664384
Hyperlipidemias	Associate	25873088
Hyperlipoproteinemia Type II	Associate	20645257
Hyperplasia	Associate	17637826
Hypertension	Associate	29914579
Hypertension	Inhibit	29914579
Hypoglycemia	Associate	22509365, 29776318
Inflammation	Associate	20645257, 20846954, 22528839, 22606221, 23049921, 25474087, 26015769, 26431381, 28128413, 31839747, 35483573
Influenza Human	Associate	21816645
Insulin Resistance	Associate	17986714, 22368174, 25061733, 31839747, 35205333, 36051387
Leukemia Lymphocytic Chronic B Cell	Associate	27932296
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26474455
Leukemia Myeloid Acute	Associate	25734857
Leydig Cell Tumor	Inhibit	32180008
Lipidoses	Associate	31839747
Lung Neoplasms	Associate	15978581, 18390835, 18566335, 18776129, 18950674, 19654299, 25043640, 33637678
Lupus Erythematosus Systemic	Associate	32566688
Melanoma	Associate	18054822, 19383853
Metabolic Diseases	Associate	17324937, 30827999
Metabolic Syndrome	Associate	18054822, 19639232, 24060638, 26673968, 28128413
Multiple Myeloma	Associate	35053305, 37048084
Muscle Spasticity	Associate	28867665
Neoplasm Metastasis	Associate	37048084
Neoplasms	Associate	11226285, 16969348, 18054822, 18349831, 18390835, 20424164, 20846954, 21346226, 21765467, 23049921, 24391853, 26578390, 26725848, 28128413, 33637678, 34921177, 35151320, 37048084 View all (3 more)
Neoplasms	Stimulate	17767717
Neoplasms	Inhibit	23208498, 26431381
Neuroblastoma	Associate	23874790
Neurodegenerative Diseases	Associate	17324937
Neurotoxicity Syndromes	Inhibit	31063584
Non alcoholic Fatty Liver Disease	Associate	31839747
Obesity	Associate	16966336, 18054822, 18379566, 18657264, 19818126, 21834910, 22990076, 23039238, 23109900, 23545576, 25670728, 26073637, 26673968, 28128413, 32078194, 36297109 View all (1 more)
Obesity	Stimulate	26694359
Obesity Abdominal	Associate	26073637
Osteosarcoma	Associate	38212774
Ovarian Neoplasms	Associate	11943708, 18349831
Overweight	Associate	23039238, 23109900
Pancreatic Neoplasms	Associate	24294133
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	17324937
Primary Ovarian Insufficiency	Associate	38107572
Psoriasis	Stimulate	17637826
Psoriasis	Associate	33683743
Pulmonary Arterial Hypertension	Associate	23607100
Pulmonary Disease Chronic Obstructive	Associate	17459894
Rectal Neoplasms	Associate	28128413
Retinitis	Associate	26015769
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	28737528
Spondylitis Ankylosing	Stimulate	26602520
Spondylolisthesis	Stimulate	36740606
Stomach Neoplasms	Associate	23907334
Thyroid Carcinoma Anaplastic	Associate	29596381
Thyroid Neoplasms	Stimulate	18701481
Urinary Bladder Neoplasms	Associate	35393513
Ventricular Remodeling	Associate	23607100
Weight Gain	Associate	36297109
Weight Loss	Associate	26073637

PPARD (peroxisome proliferator activated receptor delta)