Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54663
Gene name Gene Name - the full gene name approved by the HGNC.	WD repeat domain 74
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WDR74
Synonyms (NCBI Gene) Gene synonyms aliases	Nsa1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.3

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027617	hsa-miR-98-5p	Microarray	19088304
MIRT028577	hsa-miR-30a-5p	Proteomics	18668040
MIRT032316	hsa-let-7b-5p	Proteomics	18668040
MIRT047671	hsa-miR-10a-5p	CLASH	23622248
MIRT1491432	hsa-miR-214	CLIP-seq
MIRT1491433	hsa-miR-3619-5p	CLIP-seq
MIRT1491434	hsa-miR-4291	CLIP-seq
MIRT1491435	hsa-miR-4455	CLIP-seq
MIRT1491436	hsa-miR-4699-3p	CLIP-seq
MIRT1491437	hsa-miR-4796-3p	CLIP-seq
MIRT1491438	hsa-miR-520d-5p	CLIP-seq
MIRT1491439	hsa-miR-520g	CLIP-seq
MIRT1491440	hsa-miR-520h	CLIP-seq
MIRT1491441	hsa-miR-524-5p	CLIP-seq
MIRT1491442	hsa-miR-609	CLIP-seq
MIRT1491443	hsa-miR-761	CLIP-seq
MIRT1491444	hsa-miR-922	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000176	Component	Nuclear exosome (RNase complex)	IDA	26456651
GO:0001825	Process	Blastocyst formation	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 26456651, 28416111, 29107693
GO:0005634	Component	Nucleus	IDA	28416111
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA	21873635
GO:0005730	Component	Nucleolus	IDA	12429849, 28416111
GO:0005730	Component	Nucleolus	IDA	26456651
GO:0005730	Component	Nucleolus	IMP	29107693
GO:0006364	Process	RRNA processing	IMP	29107693
GO:0016070	Process	RNA metabolic process	ISS
GO:0030687	Component	Preribosome, large subunit precursor	IBA	21873635
GO:0042273	Process	Ribosomal large subunit biogenesis	IBA	21873635
GO:0042273	Process	Ribosomal large subunit biogenesis	IMP	26456651

MIM	HGNC	e!Ensembl
617947	25529	ENSG00000133316

Protein

UniProt ID

Q6RFH5

Protein name

WD repeat-containing protein 74 (NOP seven-associated protein 1)

Protein function

Regulatory protein of the MTREX-exosome complex involved in the synthesis of the 60S ribosomal subunit (PubMed:26456651). Participates in an early cleavage of the pre-rRNA processing pathway in cooperation with NVL (PubMed:29107693). Required fo

PDB

8FKP , 8FKR , 8FKT , 8FKV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	259 → 297	WD domain, G-beta repeat	Repeat

Sequence

MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLV
GCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTS
SDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDL
RVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGN
SVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN
PRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNKVPLEDTETDELWASLEAAAKRKL
SGLEQPQGALQTRRRKKKRPGSTSP

Sequence length

385

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	22535842

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Neoplasms	Associate	25261935
Urinary Bladder Neoplasms	Associate	36658180

WDR74 (WD repeat domain 74)