Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54659
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A3
Synonyms (NCBI Gene) Gene synonyms aliases	UDPGT, UDPGT 1-3, UGT-1C, UGT1-03, UGT1.3, UGT1A3S, UGT1C
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473357	hsa-miR-1202	CLIP-seq
MIRT1473358	hsa-miR-136	CLIP-seq
MIRT1473359	hsa-miR-3120-5p	CLIP-seq
MIRT1473360	hsa-miR-3130-3p	CLIP-seq
MIRT1473361	hsa-miR-3194-5p	CLIP-seq
MIRT1473362	hsa-miR-346	CLIP-seq
MIRT1473363	hsa-miR-3909	CLIP-seq
MIRT1473364	hsa-miR-3940-5p	CLIP-seq
MIRT1473365	hsa-miR-3972	CLIP-seq
MIRT1473366	hsa-miR-4288	CLIP-seq
MIRT1473367	hsa-miR-4421	CLIP-seq
MIRT1473368	hsa-miR-4507	CLIP-seq
MIRT1473369	hsa-miR-4766-5p	CLIP-seq
MIRT1473370	hsa-miR-4793-3p	CLIP-seq
MIRT1473371	hsa-miR-489	CLIP-seq
MIRT1473372	hsa-miR-514	CLIP-seq
MIRT1473373	hsa-miR-514b-3p	CLIP-seq
MIRT1473374	hsa-miR-548a-5p	CLIP-seq
MIRT1473375	hsa-miR-548ab	CLIP-seq
MIRT1473376	hsa-miR-548ak	CLIP-seq
MIRT1473377	hsa-miR-548b-5p	CLIP-seq
MIRT1473378	hsa-miR-548c-5p	CLIP-seq
MIRT1473379	hsa-miR-548d-5p	CLIP-seq
MIRT1473380	hsa-miR-548h	CLIP-seq
MIRT1473381	hsa-miR-548i	CLIP-seq
MIRT1473382	hsa-miR-548j	CLIP-seq
MIRT1473383	hsa-miR-548n	CLIP-seq
MIRT1473384	hsa-miR-548w	CLIP-seq
MIRT1473385	hsa-miR-548y	CLIP-seq
MIRT1473386	hsa-miR-559	CLIP-seq
MIRT1473387	hsa-miR-629	CLIP-seq
MIRT1473388	hsa-miR-632	CLIP-seq
MIRT2142601	hsa-miR-579	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	18719240
GO:0008210	Process	Estrogen metabolic process	ISS
GO:0015020	Function	Glucuronosyltransferase activity	IDA	17179145, 18052087, 18719240, 20056724, 20308471, 22579593
GO:0016021	Component	Integral component of membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0032782	Process	Bile acid secretion	IDA	23756265
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0052695	Process	Cellular glucuronidation	IDA	17179145, 18719240, 22579593
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052696	Process	Flavonoid glucuronidation	IDA	20056724
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IDA	20056724
GO:0070640	Process	Vitamin D3 metabolic process	IDA	23756265

MIM	HGNC	e!Ensembl
606428	12535	ENSG00000288702

Protein

UniProt ID

P35503

Protein name

UDP-glucuronosyltransferase 1A3 (UGT1A3) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-3) (UDPGT 1-3) (UGT1*3) (UGT1-03) (UGT1.3) (UDP-glucuronosyltransferase 1-C) (UGT-1C) (UGT1C) (UDP-glucuronosyltransferase 1A isoform 3)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	29 → 525	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in liver, kidney, colon, esophagus and small intestine. {ECO:0000269|PubMed:18004212}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in liver, kidney and colon. Not expressed in esophagus and small intestine. {ECO:

Sequence

MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVV
LTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNM
SLVYHRSCVELLHNEALIRHLNATSFDVVLTDPVNLCAAVLAKYLSIPTVFFLRNIPCDL
DFKGTQCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICHAFSAPYASLASELFQ
REVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANRKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

534

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	26697581, 11182932, 15712364
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21822266

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome			GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	24047243
Breast Neoplasms	Associate	34886806
Cholelithiasis	Associate	39840844
Colorectal Neoplasms	Associate	24677636
Gastroschisis	Associate	31075877
Neoplasms	Stimulate	25743847
Pancreatic Neoplasms	Associate	25743847
Stomach Neoplasms	Associate	25712374
Thyroid Neoplasms	Associate	24910925
Urinary Bladder Neoplasms	Associate	36124064

UGT1A3 (UDP glucuronosyltransferase family 1 member A3)