Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5462
Gene name Gene Name - the full gene name approved by the HGNC.
POU class 5 homeobox 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
POU5F1B
Synonyms (NCBI Gene) Gene synonyms aliases
OCT4-PG1, OCT4PG1, OTF3C, OTF3P1, POU5F1P1, POU5F1P4, POU5FLC20, POU5FLC8
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.21
Summary Summary of gene provided in NCBI Entrez Gene.
This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT639980 hsa-miR-4318 HITS-CLIP 23824327
MIRT639979 hsa-miR-892a HITS-CLIP 23824327
MIRT639978 hsa-miR-6840-3p HITS-CLIP 23824327
MIRT639977 hsa-miR-1915-3p HITS-CLIP 23824327
MIRT639976 hsa-miR-6764-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615739 9223 ENSG00000212993
Protein
UniProt ID Q06416
Protein name POU domain, class 5, transcription factor 1B (Oct4-pg1) (Octamer-binding protein 3-like) (Octamer-binding transcription factor 3-like)
Protein function Shows weak transcriptional activator activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 141 212 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 231 286 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in epithelial cells of the prostate (at protein level) (PubMed:20017164). Detected at the mRNA level in several cancer tissues (breast, uterine cervix, lung, thyroid gland, esophagus, colon, urinary bladder, and glioma) (PubMe
Sequence
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPG
AVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFS
QKTICRFEALQLSFKNMCKLRPLLQKWVEEAD
NNENLQEICKAETLMQARKRKRTSIENR
VRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKR
SSSDYAQREDFEAA
GSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Signaling pathways regulating pluripotency of stem cells  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Postmenopausal breast cancer, Breast cancer (estrogen-receptor negative) N/A N/A GWAS
Breast cancer Breast cancer, Breast cancer (early onset) N/A N/A GWAS
Colorectal Cancer Colorectal cancer (PheCode 153), ICD10 C18, C19, C20: colorectal cancer, Early onset colorectal cancer, Colorectal cancer N/A N/A GWAS
Diabetes Type 2 diabetes or prostate cancer (pleiotropy) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 25562676
Breast Neoplasms Associate 24338422
Colorectal Neoplasms Associate 24338422, 25315430, 29727690, 35812248
Colorectal Neoplasms Stimulate 34934770
Esophageal Neoplasms Associate 30763293
Leukemia Myeloid Acute Associate 31271156, 32436945
Neoplasms Associate 30287838, 30763293, 33551988, 34934770
Prostatic Neoplasms Associate 19562729, 21372204, 24581739, 26934861, 28463958
Stomach Neoplasms Associate 25046748
Thyroid Cancer Papillary Associate 25562676, 33551988