Gene Gene information from NCBI Gene database.
Entrez ID 5462
Gene name POU class 5 homeobox 1B
Gene symbol POU5F1B
Synonyms (NCBI Gene)
OCT4-PG1OCT4PG1OTF3COTF3P1POU5F1P1POU5F1P4POU5FLC20POU5FLC8
Chromosome 8
Chromosome location 8q24.21
Summary This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5
miRNA miRNA information provided by mirtarbase database.
60
miRTarBase ID miRNA Experiments Reference
MIRT639980 hsa-miR-4318 HITS-CLIP 23824327
MIRT639979 hsa-miR-892a HITS-CLIP 23824327
MIRT639978 hsa-miR-6840-3p HITS-CLIP 23824327
MIRT639977 hsa-miR-1915-3p HITS-CLIP 23824327
MIRT639976 hsa-miR-6764-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615739 9223 ENSG00000212993
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q06416
Protein name POU domain, class 5, transcription factor 1B (Oct4-pg1) (Octamer-binding protein 3-like) (Octamer-binding transcription factor 3-like)
Protein function Shows weak transcriptional activator activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00157 Pou 141 212 Pou domain - N-terminal to homeobox domain Domain
PF00046 Homeodomain 231 286 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in epithelial cells of the prostate (at protein level) (PubMed:20017164). Detected at the mRNA level in several cancer tissues (breast, uterine cervix, lung, thyroid gland, esophagus, colon, urinary bladder, and glioma) (PubMe
Sequence
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPG
AVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFS
QKTICRFEALQLSFKNMCKLRPLLQKWVEEAD
NNENLQEICKAETLMQARKRKRTSIENR
VRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKR
SSSDYAQREDFEAA
GSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Signaling pathways regulating pluripotency of stem cells