Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54600
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A9
Synonyms (NCBI Gene) Gene synonyms aliases	HLUGP4, LUGP4, UDPGT, UDPGT 1-9, UGT-1I, UGT1-09, UGT1-9, UGT1.9, UGT1A9S, UGT1AI, UGT1I
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473549	hsa-miR-1202	CLIP-seq
MIRT1473550	hsa-miR-136	CLIP-seq
MIRT1473551	hsa-miR-3120-5p	CLIP-seq
MIRT1473552	hsa-miR-3130-3p	CLIP-seq
MIRT1473553	hsa-miR-3194-5p	CLIP-seq
MIRT1473554	hsa-miR-346	CLIP-seq
MIRT1473555	hsa-miR-3909	CLIP-seq
MIRT1473556	hsa-miR-3940-5p	CLIP-seq
MIRT1473557	hsa-miR-3972	CLIP-seq
MIRT1473558	hsa-miR-4288	CLIP-seq
MIRT1473559	hsa-miR-4421	CLIP-seq
MIRT1473560	hsa-miR-4507	CLIP-seq
MIRT1473561	hsa-miR-4766-5p	CLIP-seq
MIRT1473562	hsa-miR-4793-3p	CLIP-seq
MIRT1473563	hsa-miR-489	CLIP-seq
MIRT1473564	hsa-miR-514	CLIP-seq
MIRT1473565	hsa-miR-514b-3p	CLIP-seq
MIRT1473566	hsa-miR-548a-5p	CLIP-seq
MIRT1473567	hsa-miR-548ab	CLIP-seq
MIRT1473568	hsa-miR-548ak	CLIP-seq
MIRT1473569	hsa-miR-548b-5p	CLIP-seq
MIRT1473570	hsa-miR-548c-5p	CLIP-seq
MIRT1473571	hsa-miR-548d-5p	CLIP-seq
MIRT1473572	hsa-miR-548h	CLIP-seq
MIRT1473573	hsa-miR-548i	CLIP-seq
MIRT1473574	hsa-miR-548j	CLIP-seq
MIRT1473575	hsa-miR-548n	CLIP-seq
MIRT1473576	hsa-miR-548w	CLIP-seq
MIRT1473577	hsa-miR-548y	CLIP-seq
MIRT1473578	hsa-miR-559	CLIP-seq
MIRT1473579	hsa-miR-629	CLIP-seq
MIRT1473580	hsa-miR-632	CLIP-seq
MIRT2142607	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
HNF1A	Activation	15044625
PPARA	Activation	12582161
PPARG	Activation	12582161

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	1910331
GO:0015020	Function	Glucuronosyltransferase activity	IDA	18052087, 20056724, 20308471, 22579593
GO:0016021	Component	Integral component of membrane	IEA
GO:0019216	Process	Regulation of lipid metabolic process	TAS
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0051552	Process	Flavone metabolic process	IDA	18052087
GO:0052695	Process	Cellular glucuronidation	IDA	22579593
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052696	Process	Flavonoid glucuronidation	IDA	20056724
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IDA	20056724

MIM	HGNC	e!Ensembl
606434	12541	ENSG00000241119

Protein

UniProt ID

O60656

Protein name

UDP-glucuronosyltransferase 1A9 (UGT1A9) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-9) (UDPGT 1-9) (UGT1*9) (UGT1-09) (UGT1.9) (UDP-glucuronosyltransferase 1-I) (UGT-1I) (UGT1I) (lugP4)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in liver, kidney, colon, esophagus and small intestine. {ECO:0000269|PubMed:18004212}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in liver, kidney, colon, esophagus and small intestine. {ECO:0000269|PubMed:18004

Sequence

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation PPARA activates gene expression

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	11182932, 26697581, 15712364
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Attention Deficit Hyperactivity Disorder	Attention Deficit Hyperactivity Disorder	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	22071170, 33671849, 34886806
Carcinogenesis	Associate	40026294
Carcinoma Hepatocellular	Associate	26010150
Carcinoma Non Small Cell Lung	Associate	32072637
Carcinoma Renal Cell	Associate	36571650
Chemical and Drug Induced Liver Injury	Associate	27500989
Colorectal Neoplasms	Associate	18675828, 24822274, 28637434, 29282011, 31698983
Death	Associate	32072637
Dermatitis Atopic	Associate	27549213
Diabetes Mellitus Type 2	Associate	25368098
Diarrhea	Associate	22912756
Drug Related Side Effects and Adverse Reactions	Associate	24033692, 25175642
Embolism Fat	Associate	25246029
Environmental Illness	Associate	10024527
Epilepsy	Associate	37858371
Fatty Liver	Associate	25246029
Gastroschisis	Associate	31075877
Hand Foot Syndrome	Associate	22736425
Hematologic Diseases	Associate	20628391, 24033692
Hyperbilirubinemia	Associate	36639636
Hypothyroidism	Associate	37563580
Neoplasms	Associate	16547397, 16547398, 24822274, 25288013, 26010150, 36571650, 40026294
Neutropenia	Associate	23386248
Non alcoholic Fatty Liver Disease	Inhibit	23223517
Ovarian Neoplasms	Associate	32894980
Pancreatic Neoplasms	Associate	17072959
Rectal Neoplasms	Associate	24822274
Stomach Neoplasms	Associate	25712374
Urinary Bladder Neoplasms	Associate	20972438, 22228101, 23284801, 23632476, 25347272, 26374428, 29028944

UGT1A9 (UDP glucuronosyltransferase family 1 member A9)