Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54600
Gene name	UDP glucuronosyltransferase family 1 member A9
Gene symbol	UGT1A9
Synonyms (NCBI Gene)	HLUGP4LUGP4UDPGTUDPGT 1-9UGT-1IUGT1-09UGT1-9UGT1.9UGT1A9SUGT1AIUGT1I
Chromosome	2
Chromosome location	2q37.1
Summary	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments
MIRT1473549	hsa-miR-1202	CLIP-seq
MIRT1473550	hsa-miR-136	CLIP-seq
MIRT1473551	hsa-miR-3120-5p	CLIP-seq
MIRT1473552	hsa-miR-3130-3p	CLIP-seq
MIRT1473553	hsa-miR-3194-5p	CLIP-seq
MIRT1473554	hsa-miR-346	CLIP-seq
MIRT1473555	hsa-miR-3909	CLIP-seq
MIRT1473556	hsa-miR-3940-5p	CLIP-seq
MIRT1473557	hsa-miR-3972	CLIP-seq
MIRT1473558	hsa-miR-4288	CLIP-seq
MIRT1473559	hsa-miR-4421	CLIP-seq
MIRT1473560	hsa-miR-4507	CLIP-seq
MIRT1473561	hsa-miR-4766-5p	CLIP-seq
MIRT1473562	hsa-miR-4793-3p	CLIP-seq
MIRT1473563	hsa-miR-489	CLIP-seq
MIRT1473564	hsa-miR-514	CLIP-seq
MIRT1473565	hsa-miR-514b-3p	CLIP-seq
MIRT1473566	hsa-miR-548a-5p	CLIP-seq
MIRT1473567	hsa-miR-548ab	CLIP-seq
MIRT1473568	hsa-miR-548ak	CLIP-seq
MIRT1473569	hsa-miR-548b-5p	CLIP-seq
MIRT1473570	hsa-miR-548c-5p	CLIP-seq
MIRT1473571	hsa-miR-548d-5p	CLIP-seq
MIRT1473572	hsa-miR-548h	CLIP-seq
MIRT1473573	hsa-miR-548i	CLIP-seq
MIRT1473574	hsa-miR-548j	CLIP-seq
MIRT1473575	hsa-miR-548n	CLIP-seq
MIRT1473576	hsa-miR-548w	CLIP-seq
MIRT1473577	hsa-miR-548y	CLIP-seq
MIRT1473578	hsa-miR-559	CLIP-seq
MIRT1473579	hsa-miR-629	CLIP-seq
MIRT1473580	hsa-miR-632	CLIP-seq
MIRT2142607	hsa-miR-579	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HNF1A	Activation	15044625
PPARA	Activation	12582161
PPARG	Activation	12582161

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IBA
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	IDA	20610558
GO:0005515	Function	Protein binding	IPI	20610558, 27857056
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IKR	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	20610558
GO:0006805	Process	Xenobiotic metabolic process	IDA	1910331, 20056724
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0009812	Process	Flavonoid metabolic process	IDA	20056724
GO:0015020	Function	Glucuronosyltransferase activity	IDA	15231852, 18052087, 20056724, 20308471, 21422672, 22579593, 38211441
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IGI	20610558
GO:0015020	Function	Glucuronosyltransferase activity	ISS	20610558
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145, 20610558
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042802	Function	Identical protein binding	IPI	27025983
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IDA	20610558
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20610558
GO:0051552	Process	Flavone metabolic process	IDA	18052087

MIM	HGNC	e!Ensembl
606434	12541	ENSG00000241119

O60656

Protein name

UDP-glucuronosyltransferase 1A9 (UGT1A9) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-9) (UDPGT 1-9) (UGT1*9) (UGT1-09) (UGT1.9) (UDP-glucuronosyltransferase 1-I) (UGT-1I) (UGT1I) (lugP4)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in liver, kidney, colon, esophagus and small intestine. {ECO:0000269|PubMed:18004212}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in liver, kidney, colon, esophagus and small intestine. {ECO:0000269|PubMed:18004

Sequence

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation PPARA activates gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIRUBIN METABOLISM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER-NAJJAR SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILBERT DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUCEY-DRISCOLL SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERINATAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UGT1A9-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	22071170, 33671849, 34886806	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	40026294	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	26010150	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	32072637	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	36571650	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	27500989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	18675828, 24822274, 28637434, 29282011, 31698983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	32072637	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	27549213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	25368098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Associate	22912756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	24033692, 25175642	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism Fat	Associate	25246029	★★★★★ ★☆☆☆☆ Found in Text Mining only
Environmental Illness	Associate	10024527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	37858371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	25246029	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Associate	31075877	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hand Foot Syndrome	Associate	22736425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	20628391, 24033692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Associate	36639636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Associate	37563580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16547397, 16547398, 24822274, 25288013, 26010150, 36571650, 40026294	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Associate	23386248	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Inhibit	23223517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	32894980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	17072959	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	24822274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	25712374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	20972438, 22228101, 23284801, 23632476, 25347272, 26374428, 29028944	★★★★★ ★☆☆☆☆ Found in Text Mining only

UGT1A9 (UDP glucuronosyltransferase family 1 member A9)