Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54583
Gene name Gene Name - the full gene name approved by the HGNC.
Egl-9 family hypoxia inducible factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EGLN1
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf12, ECYT3, HALAH, HIF-PH2, HIFPH2, HPH-2, HPH2, PHD2, SM20, ZMYND6
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein func
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs12097901 C>G Affects, benign Missense variant, coding sequence variant
rs80358193 G>C Pathogenic Missense variant, coding sequence variant
rs119476044 C>T Pathogenic Missense variant, intron variant, coding sequence variant
rs119476045 T>C Pathogenic Missense variant, intron variant, coding sequence variant
rs186996510 G>C Affects, benign, likely-benign Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016815 hsa-miR-335-5p Microarray 18185580
MIRT038498 hsa-miR-296-3p CLASH 23622248
MIRT544371 hsa-miR-548n PAR-CLIP 21572407
MIRT544370 hsa-miR-548az-5p PAR-CLIP 21572407
MIRT544369 hsa-miR-548t-5p PAR-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
ETV4 Unknown 22075993
HIF1A Unknown 12839937;22075993
SIRT1 Repression 22245592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IDA 16956324
GO:0004857 Function Enzyme inhibitor activity ISS
GO:0005506 Function Iron ion binding IEA
GO:0005515 Function Protein binding IPI 15721254, 16511565, 17353276, 19208626, 20840591, 22286099, 24169621, 24681946, 25974097, 30487161
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606425 1232 ENSG00000135766
Protein
UniProt ID Q9GZT9
Protein name Egl nine homolog 1 (EC 1.14.11.29) (Hypoxia-inducible factor prolyl hydroxylase 2) (HIF-PH2) (HIF-prolyl hydroxylase 2) (HPH-2) (Prolyl hydroxylase domain-containing protein 2) (PHD2) (SM-20)
Protein function Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degrad
PDB 2G19 , 2G1M , 2HBT , 2HBU , 2Y33 , 2Y34 , 3HQR , 3HQU , 3OUH , 3OUI , 3OUJ , 4BQW , 4BQX , 4BQY , 4JZR , 4KBZ , 4UWD , 5A3U , 5L9B , 5L9R , 5L9V , 5LA9 , 5LAS , 5LAT , 5LB6 , 5LBB , 5LBC , 5LBE , 5LBF , 5OX5 , 5OX6 , 5V18 , 6NMQ , 6QGV , 6ST3 , 6YVT , 6YVW , 6YVX , 6YVZ , 6YW0 , 6YW1 , 6YW2 , 6YW3 , 6YW4 , 6ZBN , 6ZBO , 7Q5V , 7Q5X , 7UJV , 7UMP , 8J1K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01753 zf-MYND 21 58 MYND finger Domain
PF13640 2OG-FeII_Oxy_3 298 391 2OG-Fe(II) oxygenase superfamily Domain
Tissue specificity TISSUE SPECIFICITY: According to PubMed:11056053, widely expressed with highest levels in skeletal muscle and heart, moderate levels in pancreas, brain (dopaminergic neurons of adult and fetal substantia nigra) and kidney, and lower levels in lung and liv
Sequence
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYF
DADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Sequence length 426
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  HIF-1 signaling pathway
Pathways in cancer
Renal cell carcinoma
  Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Erythrocytosis erythrocytosis, familial, 3 rs119476044, rs119476045, rs1018129986 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cutaneous mastocytosis Cutaneous mastocytosis N/A N/A GWAS
Hereditary Pheochromocytoma-Paraganglioma hereditary pheochromocytoma-paraganglioma N/A N/A GenCC
Polycythemia autosomal dominant secondary polycythemia N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Stimulate 30575913
Alopecia Associate 35862273
Altitude Sickness Associate 25431923, 32478477
Anemia Associate 20973793
Arthritis Associate 22488178
Arthritis Psoriatic Associate 22488178
Arthritis Rheumatoid Associate 22488178
Breast Neoplasms Associate 28038470, 37661833
Calcinosis Cutis Associate 36013579
Carcinogenesis Associate 22236543, 25546659