SCAND2P (SCAN domain containing 2 pseudogene)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54581
Gene name Gene Name - the full gene name approved by the HGNC.
SCAN domain containing 2 pseudogene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCAND2P
Synonyms (NCBI Gene) Gene synonyms aliases
SCAND2
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT018118 hsa-miR-335-5p Microarray 18185580
MIRT029695 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610417 10567 HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9GZW5
Protein name Putative SCAN domain-containing protein SCAND2P (SCAN domain-containing protein 2 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 41 → 130 SCAN domain Domain
Sequence 
MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPR
EALLQLQKLCCQWLRPEKCTKEQILELLVLEQFPTVLLQEIQIWVRQQHPESGEEAVALV
EDLQKEPGRQRLEPRARPSGRTPPAQLRSPWPMTAAGPASRARASETGSTASCAGRWRTC
CAAAAAPSAARSASARTGRSTSSCARAARAPSATEGALTRTPAPRRPLQRRRPGTGPWRP
GRQRGAGTAPPGTQPRQRPSPRPTPRRPRPRLARPRAGQKPWLLVIRSMERVMYVMLIIQ
METEDV
Sequence length 306
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Galloway-mowat syndrome GALLOWAY-MOWAT SYNDROME 1 rs727502863, rs727502864, rs730882216, rs797044992, rs767086146, rs754099015, rs797044993, rs797044994, rs797044995, rs863223396, rs869320712, rs776760122, rs1555976610, rs1557211306, rs1557211209
View all (22 more)		 25466283
Show/Hide Text Mining Associations (6)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 36982267
Adenocarcinoma of Lung Associate 36982267
Head and Neck Neoplasms Stimulate 36982267
Neoplasms Associate 36982267
Pancreatic Neoplasms Stimulate 36982267
Sarcoma Associate 36982267