Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54579
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A5
Synonyms (NCBI Gene) Gene synonyms aliases	UDPGT, UDPGT 1-5, UGT1E
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473421	hsa-miR-1202	CLIP-seq
MIRT1473422	hsa-miR-136	CLIP-seq
MIRT1473423	hsa-miR-3120-5p	CLIP-seq
MIRT1473424	hsa-miR-3130-3p	CLIP-seq
MIRT1473425	hsa-miR-3194-5p	CLIP-seq
MIRT1473426	hsa-miR-346	CLIP-seq
MIRT1473427	hsa-miR-3909	CLIP-seq
MIRT1473428	hsa-miR-3940-5p	CLIP-seq
MIRT1473429	hsa-miR-3972	CLIP-seq
MIRT1473430	hsa-miR-4288	CLIP-seq
MIRT1473431	hsa-miR-4421	CLIP-seq
MIRT1473432	hsa-miR-4507	CLIP-seq
MIRT1473433	hsa-miR-4766-5p	CLIP-seq
MIRT1473434	hsa-miR-4793-3p	CLIP-seq
MIRT1473435	hsa-miR-489	CLIP-seq
MIRT1473436	hsa-miR-514	CLIP-seq
MIRT1473437	hsa-miR-514b-3p	CLIP-seq
MIRT1473438	hsa-miR-548a-5p	CLIP-seq
MIRT1473439	hsa-miR-548ab	CLIP-seq
MIRT1473440	hsa-miR-548ak	CLIP-seq
MIRT1473441	hsa-miR-548b-5p	CLIP-seq
MIRT1473442	hsa-miR-548c-5p	CLIP-seq
MIRT1473443	hsa-miR-548d-5p	CLIP-seq
MIRT1473444	hsa-miR-548h	CLIP-seq
MIRT1473445	hsa-miR-548i	CLIP-seq
MIRT1473446	hsa-miR-548j	CLIP-seq
MIRT1473447	hsa-miR-548n	CLIP-seq
MIRT1473448	hsa-miR-548w	CLIP-seq
MIRT1473449	hsa-miR-548y	CLIP-seq
MIRT1473450	hsa-miR-559	CLIP-seq
MIRT1473451	hsa-miR-629	CLIP-seq
MIRT1473452	hsa-miR-632	CLIP-seq
MIRT2142603	hsa-miR-579	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635

MIM	HGNC	e!Ensembl
606430	12537	ENSG00000288705

Protein

UniProt ID

P35504

Protein name

UDP-glucuronosyltransferase 1A5 (UGT1A5) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-5) (UDPGT 1-5) (UGT1*5) (UGT1-05) (UGT1.5) (UDP-glucuronosyltransferase 1-E) (UGT-1E) (UGT1E)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	29 → 525	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in colon and small intestine. Neither isoform is expressed in liver, kidney or esophagus. {ECO:0000269|PubMed:18004212}.

Sequence

MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVV
LTLEVNMYIKEENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM
SLIIHRSCVELLHNEALIRHLHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDL
DFKGTQCPNPSSYIPRLLTTNSDHMTFLQRVKNMLYPLALSYLCHAVSAPYASLASELFQ
REVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

534

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	26697581, 11182932, 15712364
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome			GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Hepatocellular	Associate	37622118
Gastroschisis	Associate	31075877
Neoplasms	Associate	23468910
Stomach Neoplasms	Associate	25712374

UGT1A5 (UDP glucuronosyltransferase family 1 member A5)