Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54578
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A6
Synonyms (NCBI Gene) Gene synonyms aliases	GNT1, HLUGP, HLUGP1, UDPGT, UDPGT 1-6, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A, UGT1A1, UGT1A3, UGT1A5, UGT1A6S, UGT1C, UGT1E, UGT1F, hUG-BR1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473453	hsa-miR-1202	CLIP-seq
MIRT1473454	hsa-miR-136	CLIP-seq
MIRT1473455	hsa-miR-3120-5p	CLIP-seq
MIRT1473456	hsa-miR-3130-3p	CLIP-seq
MIRT1473457	hsa-miR-3194-5p	CLIP-seq
MIRT1473458	hsa-miR-346	CLIP-seq
MIRT1473459	hsa-miR-3909	CLIP-seq
MIRT1473460	hsa-miR-3940-5p	CLIP-seq
MIRT1473461	hsa-miR-3972	CLIP-seq
MIRT1473462	hsa-miR-4288	CLIP-seq
MIRT1473463	hsa-miR-4421	CLIP-seq
MIRT1473464	hsa-miR-4507	CLIP-seq
MIRT1473465	hsa-miR-4766-5p	CLIP-seq
MIRT1473466	hsa-miR-4793-3p	CLIP-seq
MIRT1473467	hsa-miR-489	CLIP-seq
MIRT1473468	hsa-miR-514	CLIP-seq
MIRT1473469	hsa-miR-514b-3p	CLIP-seq
MIRT1473470	hsa-miR-548a-5p	CLIP-seq
MIRT1473471	hsa-miR-548ab	CLIP-seq
MIRT1473472	hsa-miR-548ak	CLIP-seq
MIRT1473473	hsa-miR-548b-5p	CLIP-seq
MIRT1473474	hsa-miR-548c-5p	CLIP-seq
MIRT1473475	hsa-miR-548d-5p	CLIP-seq
MIRT1473476	hsa-miR-548h	CLIP-seq
MIRT1473477	hsa-miR-548i	CLIP-seq
MIRT1473478	hsa-miR-548j	CLIP-seq
MIRT1473479	hsa-miR-548n	CLIP-seq
MIRT1473480	hsa-miR-548w	CLIP-seq
MIRT1473481	hsa-miR-548y	CLIP-seq
MIRT1473482	hsa-miR-559	CLIP-seq
MIRT1473483	hsa-miR-629	CLIP-seq
MIRT1473484	hsa-miR-632	CLIP-seq
MIRT2142604	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
AHR	Unknown	9466822
ARNT	Unknown	20854796

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	ISS	20610558
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IKR	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	3141926
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IKR	20610558
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	15231852, 21422672, 22579593
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IKR	20610558
GO:0015020	Function	Glucuronosyltransferase activity	ISS	20610558
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145, 20610558
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	ISS	20610558
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20610558

MIM	HGNC	e!Ensembl
606431	12538	ENSG00000167165

Protein

UniProt ID

P19224

Protein name

UDP-glucuronosyltransferase 1A6 (UGT1A6) (EC 2.4.1.17) (Phenol-metabolizing UDP-glucuronosyltransferase) (UDP-glucuronosyltransferase 1-6) (UDPGT 1-6) (UGT1*6) (UGT1-06) (UGT1.6) (UDP-glucuronosyltransferase 1-F) (UGT-1F) (UGT1F)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:15231852,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	27 → 523	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin. Isoforms 1 and 3 are expressed in kidney and liver. Isoform 1 but not isoform 2 is expressed in colon, esophagus and small intestine. {ECO:0000269|PubMed:1339448, ECO:0000269|PubMed:18004212}.

Sequence

MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

532

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cholelithiasis	Cholelithiasis	N/A	N/A	GWAS
Metabolic Syndrome	Serum bilirubin levels in metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	33050938
Brain Injuries Traumatic	Associate	28841884
Breast Neoplasms	Associate	34886806
Carcinoid Tumor	Associate	22450351
Carcinoma Renal Cell	Associate	36571650
Cardiomyopathies	Associate	26968791
Cardiotoxicity	Associate	33900042, 38547766
Cardiovascular Diseases	Associate	26517138
Colorectal Neoplasms	Stimulate	24677636
Colorectal Neoplasms	Associate	31698983
Crigler Najjar Syndrome	Associate	1634606, 8102509
Diarrhea	Associate	28817838
Epilepsy	Associate	23099353, 25751467
Epilepsy Post Traumatic	Associate	28841884
Gallstones	Associate	26039129
Gastrointestinal Diseases	Associate	19415281, 23963147
Gastroschisis	Associate	31075877
Gilbert Disease	Associate	22450351
Hepatitis C	Associate	29695616
Hyperbilirubinemia	Associate	26039129, 39457450
Liver Failure Acute	Associate	23408116
Lung Neoplasms	Associate	22912755
Neoplasms	Associate	22450351, 25288013, 25650382, 25927723
Neutropenia	Associate	20860988
Non alcoholic Fatty Liver Disease	Inhibit	23223517
Pancreatic Neoplasms	Associate	34595239
Seizures	Associate	28841884
Stomach Neoplasms	Stimulate	25712374
Urinary Bladder Neoplasms	Associate	23536561

UGT1A6 (UDP glucuronosyltransferase family 1 member A6)