Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	54577
Gene name	UDP glucuronosyltransferase family 1 member A7
Gene symbol	UGT1A7
Synonyms (NCBI Gene)	GNT1UDPGTUDPGT 1-7UGT-1AUGT-1GUGT1UGT1-01UGT1-07UGT1.1UGT1.7UGT1AUGT1A1UGT1GhUG-BR1
Chromosome	2
Chromosome location	2q37.1
Summary	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments
MIRT1473485	hsa-miR-1202	CLIP-seq
MIRT1473486	hsa-miR-136	CLIP-seq
MIRT1473487	hsa-miR-3120-5p	CLIP-seq
MIRT1473488	hsa-miR-3130-3p	CLIP-seq
MIRT1473489	hsa-miR-3194-5p	CLIP-seq
MIRT1473490	hsa-miR-346	CLIP-seq
MIRT1473491	hsa-miR-3909	CLIP-seq
MIRT1473492	hsa-miR-3940-5p	CLIP-seq
MIRT1473493	hsa-miR-3972	CLIP-seq
MIRT1473494	hsa-miR-4288	CLIP-seq
MIRT1473495	hsa-miR-4421	CLIP-seq
MIRT1473496	hsa-miR-4507	CLIP-seq
MIRT1473497	hsa-miR-4766-5p	CLIP-seq
MIRT1473498	hsa-miR-4793-3p	CLIP-seq
MIRT1473499	hsa-miR-489	CLIP-seq
MIRT1473500	hsa-miR-514	CLIP-seq
MIRT1473501	hsa-miR-514b-3p	CLIP-seq
MIRT1473502	hsa-miR-548a-5p	CLIP-seq
MIRT1473503	hsa-miR-548ab	CLIP-seq
MIRT1473504	hsa-miR-548ak	CLIP-seq
MIRT1473505	hsa-miR-548b-5p	CLIP-seq
MIRT1473506	hsa-miR-548c-5p	CLIP-seq
MIRT1473507	hsa-miR-548d-5p	CLIP-seq
MIRT1473508	hsa-miR-548h	CLIP-seq
MIRT1473509	hsa-miR-548i	CLIP-seq
MIRT1473510	hsa-miR-548j	CLIP-seq
MIRT1473511	hsa-miR-548n	CLIP-seq
MIRT1473512	hsa-miR-548w	CLIP-seq
MIRT1473513	hsa-miR-548y	CLIP-seq
MIRT1473514	hsa-miR-559	CLIP-seq
MIRT1473515	hsa-miR-629	CLIP-seq
MIRT1473516	hsa-miR-632	CLIP-seq
MIRT2142605	hsa-miR-579	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
HNF1A	Unknown	20406851
HNF4A	Unknown	20406851

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001889	Process	Liver development	IBA
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	IDA	19996319, 20610558
GO:0005080	Function	Protein kinase C binding	IPI	18556656
GO:0005515	Function	Protein binding	IPI	20610558
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145, 18556656
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IKR	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20610558
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IDA	20610558
GO:0006805	Process	Xenobiotic metabolic process	IC	19996319
GO:0006805	Process	Xenobiotic metabolic process	IDA	20610558
GO:0006805	Process	Xenobiotic metabolic process	IDA	20056724, 20610558
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008210	Process	Estrogen metabolic process	IDA	18719240
GO:0009407	Process	Toxin catabolic process	IDA	18556656
GO:0009804	Process	Coumarin metabolic process	IC	19996319
GO:0009812	Process	Flavonoid metabolic process	IDA	20056724
GO:0015020	Function	Glucuronosyltransferase activity	IDA	17179145, 18052087, 18719240, 19996319, 20056724, 20308471, 20610558, 21422672, 38211441
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IGI	20610558
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145, 20610558
GO:0042178	Process	Xenobiotic catabolic process	IDA	18556656
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IDA	20610558
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20610558
GO:0051552	Process	Flavone metabolic process	IC	18052087

MIM	HGNC	e!Ensembl
606432	12539	ENSG00000244122

Q9HAW7

Protein name

UDP-glucuronosyltransferase 1A7 (UGT1A7) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-7) (UDPGT 1-7) (UGT1*7) (UGT1-07) (UGT1.7) (UDP-glucuronosyltransferase 1-G) (UGT-1G) (UGT1G)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Liver and gastric tissue (PubMed:9271343). Isoform 1 and isoform 2 are expressed in esophagus. Neither isoform is expressed in liver, kidney, colon and small intestine (PubMed:18004212). {ECO:0000269|PubMed:18004212, ECO:0000269|PubMed

Sequence

MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF
FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

UGT1A7 (UDP glucuronosyltransferase family 1 member A7)