Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54577
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 1 member A7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT1A7
Synonyms (NCBI Gene) Gene synonyms aliases	GNT1, UDPGT, UDPGT 1-7, UGT-1A, UGT-1G, UGT1, UGT1-01, UGT1-07, UGT1.1, UGT1.7, UGT1A, UGT1A1, UGT1G, hUG-BR1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1473485	hsa-miR-1202	CLIP-seq
MIRT1473486	hsa-miR-136	CLIP-seq
MIRT1473487	hsa-miR-3120-5p	CLIP-seq
MIRT1473488	hsa-miR-3130-3p	CLIP-seq
MIRT1473489	hsa-miR-3194-5p	CLIP-seq
MIRT1473490	hsa-miR-346	CLIP-seq
MIRT1473491	hsa-miR-3909	CLIP-seq
MIRT1473492	hsa-miR-3940-5p	CLIP-seq
MIRT1473493	hsa-miR-3972	CLIP-seq
MIRT1473494	hsa-miR-4288	CLIP-seq
MIRT1473495	hsa-miR-4421	CLIP-seq
MIRT1473496	hsa-miR-4507	CLIP-seq
MIRT1473497	hsa-miR-4766-5p	CLIP-seq
MIRT1473498	hsa-miR-4793-3p	CLIP-seq
MIRT1473499	hsa-miR-489	CLIP-seq
MIRT1473500	hsa-miR-514	CLIP-seq
MIRT1473501	hsa-miR-514b-3p	CLIP-seq
MIRT1473502	hsa-miR-548a-5p	CLIP-seq
MIRT1473503	hsa-miR-548ab	CLIP-seq
MIRT1473504	hsa-miR-548ak	CLIP-seq
MIRT1473505	hsa-miR-548b-5p	CLIP-seq
MIRT1473506	hsa-miR-548c-5p	CLIP-seq
MIRT1473507	hsa-miR-548d-5p	CLIP-seq
MIRT1473508	hsa-miR-548h	CLIP-seq
MIRT1473509	hsa-miR-548i	CLIP-seq
MIRT1473510	hsa-miR-548j	CLIP-seq
MIRT1473511	hsa-miR-548n	CLIP-seq
MIRT1473512	hsa-miR-548w	CLIP-seq
MIRT1473513	hsa-miR-548y	CLIP-seq
MIRT1473514	hsa-miR-559	CLIP-seq
MIRT1473515	hsa-miR-629	CLIP-seq
MIRT1473516	hsa-miR-632	CLIP-seq
MIRT2142605	hsa-miR-579	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HNF1A	Unknown	20406851
HNF4A	Unknown	20406851

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	IDA	19996319
GO:0005080	Function	Protein kinase C binding	IDA	18556656
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145, 18556656
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0007588	Process	Excretion	IC	20056724
GO:0008210	Process	Estrogen metabolic process	IDA	18719240
GO:0009804	Process	Coumarin metabolic process	IC	19996319
GO:0015020	Function	Glucuronosyltransferase activity	IDA	17179145, 18052087, 18719240, 19996319, 20056724, 20308471
GO:0016021	Component	Integral component of membrane	IEA
GO:0017144	Process	Drug metabolic process	IC	19996319
GO:0019899	Function	Enzyme binding	IPI	17179145
GO:0042573	Process	Retinoic acid metabolic process	IC	20308471
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0051552	Process	Flavone metabolic process	IC	18052087
GO:0052695	Process	Cellular glucuronidation	IDA	17179145, 18719240
GO:0052696	Process	Flavonoid glucuronidation	IBA	21873635
GO:0052696	Process	Flavonoid glucuronidation	IDA	20056724
GO:0052697	Process	Xenobiotic glucuronidation	IBA	21873635
GO:0052697	Process	Xenobiotic glucuronidation	IDA	20056724

MIM	HGNC	e!Ensembl
606432	12539	ENSG00000244122

Protein

UniProt ID

Q9HAW7

Protein name

UDP-glucuronosyltransferase 1A7 (UGT1A7) (EC 2.4.1.17) (UDP-glucuronosyltransferase 1-7) (UDPGT 1-7) (UGT1*7) (UGT1-07) (UGT1.7) (UDP-glucuronosyltransferase 1-G) (UGT-1G) (UGT1G)

Protein function

[Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	26 → 521	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Liver and gastric tissue (PubMed:9271343). Isoform 1 and isoform 2 are expressed in esophagus. Neither isoform is expressed in liver, kidney, colon and small intestine (PubMed:18004212). {ECO:0000269|PubMed:18004212, ECO:0000269|PubMed

Sequence

MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF
FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Sickle Cell	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	22558097
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752	22558097
Crigler-najjar syndrome	Crigler Najjar syndrome, type 1, Crigler Najjar syndrome, type 2	rs587776761, rs72551353, rs111033539, rs72551349, rs72551348, rs587776762, rs62625011, rs281865418, rs587776763, rs587776764, rs587776765, rs587776766, rs34993780, rs72551351, rs111033541 View all (7 more)	11182932, 26697581, 15712364
Gilbert disease	Gilbert Disease (disorder)	rs72551349, rs62625011, rs34993780, rs72551351, rs748219743
Lucey-driscoll syndrome	Lucey-Driscoll syndrome (disorder)	rs34993780, rs3755319
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25246029

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome			GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	17436274, 34886806
Carcinogenesis	Associate	12010889, 18021430, 40026294
Carcinoma Hepatocellular	Associate	15682470, 18021430, 18271934, 29085212
Carcinoma Squamous Cell	Associate	10024527
Cardiotoxicity	Associate	38547766
Colorectal Neoplasms	Associate	12010889, 15682470, 15929176, 28637434
Diarrhea	Associate	12036456
Drug Related Side Effects and Adverse Reactions	Associate	24033692, 25175642
Environmental Illness	Associate	10024527
Esophageal Squamous Cell Carcinoma	Associate	10024527
Gastrointestinal Diseases	Associate	23963147
Gastroschisis	Associate	31075877
Hematologic Diseases	Associate	24033692
Hepatitis B	Associate	18271934
Inflammatory Bowel Diseases	Associate	16097053
Lupus Nephritis	Associate	24548980
Neoplasm Metastasis	Associate	15929176
Neoplasms	Associate	12010889, 12036456, 15682470, 16547397, 23468910, 40026294
Neoplasms	Stimulate	25743847
Neutropenia	Associate	23386248
Pancreatic Neoplasms	Associate	16199544, 25743847
Pancreatitis Chronic	Associate	15247627, 16199544
Stomach Neoplasms	Associate	25712374
Vasculitis Lymphocytic Cutaneous Small Vessel	Associate	24548980

UGT1A7 (UDP glucuronosyltransferase family 1 member A7)